DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Six4 and SIX4

DIOPT Version :9

Sequence 1:NP_649256.1 Gene:Six4 / 40297 FlyBaseID:FBgn0027364 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_059116.3 Gene:SIX4 / 51804 HGNCID:10890 Length:781 Species:Homo sapiens


Alignment Length:284 Identity:138/284 - (48%)
Similarity:171/284 - (60%) Gaps:41/284 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 SPPPTASTTPTHYPSLNSIIFENGSSGNLGDLNGNTKTDLCAGLQRSGGGLG-------GNAGSG 153
            |||     .|..:|      .|.|              |......|..|..|       |.|...
Human    44 SPP-----APAPFP------LEPG--------------DAATAAARVSGEEGAVAAAAAGAAADQ 83

  Fly   154 GHLISNLTAAHNMSAVSSFPIDAKMLQFSTDQIQCMCEALQQKGDIEKLTTFLCSLPPSEFFKTN 218
            ..|.|.|...|:.:|.::....   |.||.|.:.|:||||||.|::::|..||.|||.|:..:.|
Human    84 VQLHSELLGRHHHAAAAAAQTP---LAFSPDHVACVCEALQQGGNLDRLARFLWSLPQSDLLRGN 145

  Fly   219 ESVLRARAMVAYNLGQFHELYNLLETHCFSIKYHVDLQNLWFKAHYKEAEKVRGRPLGAVDKYRL 283
            ||:|:|||:||::.|.:.|||::||:|.|....|..||.||:||.|.|||:.|||||||||||||
Human   146 ESLLKARALVAFHQGIYPELYSILESHSFESANHPLLQQLWYKARYTEAERARGRPLGAVDKYRL 210

  Fly   284 RKKYPLPKTIWDGEETVYCFKEKSRNALKDCYLTNRYPTPDEKKTLAKKTGLTLTQVSNWFKNRR 348
            |:|:|||:|||||||||||||||||||||:.|..||||:|.||:.|||.|||:||||||||||||
Human   211 RRKFPLPRTIWDGEETVYCFKEKSRNALKELYKQNRYPSPAEKRHLAKITGLSLTQVSNWFKNRR 275

  Fly   349 QRDRTPQQRPDIMSVLPVGQLDGN 372
            ||||.|.:...      ..:.|||
Human   276 QRDRNPSETQS------KSESDGN 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Six4NP_649256.1 SIX1_SD 181..290 CDD:293483 62/108 (57%)
homeodomain 301..355 CDD:238039 42/53 (79%)
SIX4NP_059116.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55 5/21 (24%)
SIX1_SD 108..217 CDD:293483 62/108 (57%)
homeodomain 228..282 CDD:238039 42/53 (79%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 270..321 14/30 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158077
Domainoid 1 1.000 88 1.000 Domainoid score I7947
eggNOG 1 0.900 - - E1_KOG0775
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41533
orthoMCL 1 0.900 - - OOG6_109892
Panther 1 1.100 - - O PTHR10390
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3257
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.700

Return to query results.
Submit another query.