Sequence 1: | NP_649256.1 | Gene: | Six4 / 40297 | FlyBaseID: | FBgn0027364 | Length: | 392 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_031400.2 | Gene: | SIX6 / 4990 | HGNCID: | 10892 | Length: | 246 | Species: | Homo sapiens |
Alignment Length: | 210 | Identity: | 109/210 - (51%) |
---|---|---|---|
Similarity: | 148/210 - (70%) | Gaps: | 10/210 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 178 MLQFSTDQIQCMCEALQQKGDIEKLTTFLCSLPPS----EFFKTNESVLRARAMVAYNLGQFHEL 238
Fly 239 YNLLETHCFSIKYHVDLQNLWFKAHYKEAEKVRGRPLGAVDKYRLRKKYPLPKTIWDGEETVYCF 303
Fly 304 KEKSRNALKDCYLTNRYPTPDEKKTLAKKTGLTLTQVSNWFKNRRQRDRTPQQRPDI-MSVLPVG 367
Fly 368 -----QLDGNGFPRM 377 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Six4 | NP_649256.1 | SIX1_SD | 181..290 | CDD:293483 | 62/112 (55%) |
homeodomain | 301..355 | CDD:238039 | 32/53 (60%) | ||
SIX6 | NP_031400.2 | SIX1_SD | 9..122 | CDD:318970 | 62/112 (55%) |
homeodomain | 130..178 | CDD:238039 | 24/47 (51%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 190..246 | 6/26 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0775 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |