DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Six4 and SIX6

DIOPT Version :9

Sequence 1:NP_649256.1 Gene:Six4 / 40297 FlyBaseID:FBgn0027364 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_031400.2 Gene:SIX6 / 4990 HGNCID:10892 Length:246 Species:Homo sapiens


Alignment Length:210 Identity:109/210 - (51%)
Similarity:148/210 - (70%) Gaps:10/210 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 MLQFSTDQIQCMCEALQQKGDIEKLTTFLCSLPPS----EFFKTNESVLRARAMVAYNLGQFHEL 238
            :|.||..|:..:||.|::.||:|:|..||.|||.:    |....|||||||||:||::.|.:.||
Human     6 ILNFSPQQVAGVCETLEESGDVERLGRFLWSLPVAPAACEALNKNESVLRARAIVAFHGGNYREL 70

  Fly   239 YNLLETHCFSIKYHVDLQNLWFKAHYKEAEKVRGRPLGAVDKYRLRKKYPLPKTIWDGEETVYCF 303
            |::||.|.|:.:.|..||.||.:|||:||||:||||||.|||||:|||:|||:||||||:..:||
Human    71 YHILENHKFTKESHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCF 135

  Fly   304 KEKSRNALKDCYLTNRYPTPDEKKTLAKKTGLTLTQVSNWFKNRRQRDRTPQQRPDI-MSVLPVG 367
            ||::|:.|::.||.:.||.|.:|:.||:.||||.|||.|||||||||||....:..: ..||..|
Human   136 KERTRHLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNRLQQQVLSQG 200

  Fly   368 -----QLDGNGFPRM 377
                 :.:|:|.|.:
Human   201 SGRALRAEGDGTPEV 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Six4NP_649256.1 SIX1_SD 181..290 CDD:293483 62/112 (55%)
homeodomain 301..355 CDD:238039 32/53 (60%)
SIX6NP_031400.2 SIX1_SD 9..122 CDD:318970 62/112 (55%)
homeodomain 130..178 CDD:238039 24/47 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 190..246 6/26 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0775
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.