DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Six4 and Optix

DIOPT Version :9

Sequence 1:NP_649256.1 Gene:Six4 / 40297 FlyBaseID:FBgn0027364 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001260793.1 Gene:Optix / 44108 FlyBaseID:FBgn0025360 Length:492 Species:Drosophila melanogaster


Alignment Length:194 Identity:106/194 - (54%)
Similarity:137/194 - (70%) Gaps:7/194 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 HNMSAVSSFPIDA-KMLQFSTDQIQCMCEALQQKGDIEKLTTFLCSLP---PSEFFKTN-ESVLR 223
            |.:.|.|  ||.| ..|.||..|::.:|:.|:..||||:|..||.|||   |:.....| |:|||
  Fly    21 HQIIAPS--PILAVPTLAFSAAQVEIVCKTLEDSGDIERLARFLWSLPVALPNMHEILNCEAVLR 83

  Fly   224 ARAMVAYNLGQFHELYNLLETHCFSIKYHVDLQNLWFKAHYKEAEKVRGRPLGAVDKYRLRKKYP 288
            |||:|||::|.|.|||.::|.|.|:...:..||.:|.:|||.||||:|||.||.|||||:|||:|
  Fly    84 ARAVVAYHVGNFRELYAIIENHKFTKASYGKLQAMWLEAHYIEAEKLRGRSLGPVDKYRVRKKFP 148

  Fly   289 LPKTIWDGEETVYCFKEKSRNALKDCYLTNRYPTPDEKKTLAKKTGLTLTQVSNWFKNRRQRDR 352
            ||.||||||:..:||||::|:.|::.||.:.||.|.:|:.|||.|||..|||.|||||||||||
  Fly   149 LPPTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPTKKRELAKATGLNPTQVGNWFKNRRQRDR 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Six4NP_649256.1 SIX1_SD 181..290 CDD:293483 59/112 (53%)
homeodomain 301..355 CDD:238039 32/52 (62%)
OptixNP_001260793.1 SIX1_SD 37..150 CDD:293483 59/112 (53%)
homeodomain 158..206 CDD:238039 24/47 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467664
Domainoid 1 1.000 48 1.000 Domainoid score I4491
eggNOG 1 0.900 - - E1_KOG0775
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I2393
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1040044at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10390
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.