DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Six4 and so

DIOPT Version :9

Sequence 1:NP_649256.1 Gene:Six4 / 40297 FlyBaseID:FBgn0027364 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_476733.1 Gene:so / 35662 FlyBaseID:FBgn0003460 Length:416 Species:Drosophila melanogaster


Alignment Length:295 Identity:143/295 - (48%)
Similarity:184/295 - (62%) Gaps:33/295 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 TASTTPTHYPS--LNSIIFENGSSGNLGDLNGNTKT-DLCAGLQRSGGGLGG--------NAGSG 153
            ||..||.:.|:  ..|:...|.::.|....|.|..| |:.|   .:|||.||        |.|.|
  Fly    22 TARHTPPYSPTGLSGSVALHNNNNNNSSTSNNNNSTLDIMA---HNGGGAGGGLHLNSSSNGGGG 83

  Fly   154 GHLISNLTAAHNMSAVSSFPIDAKMLQFSTDQIQCMCEALQQKGDIEKLTTFLCSLPPSEFFKTN 218
            |.::|. ..:.....:.||       .|:.:|:.|:||.|||.|:||:|..||.|||..:..:.|
  Fly    84 GGVVSG-GGSGGRENLPSF-------GFTQEQVACVCEVLQQAGNIERLGRFLWSLPQCDKLQLN 140

  Fly   219 ESVLRARAMVAYNLGQFHELYNLLETHCFSIKYHVDLQNLWFKAHYKEAEKVRGRPLGAVDKYRL 283
            ||||:|:|:||::.||:.|||.|||.|.||.:.|..||.||.||||.||||:||||||||.|||:
  Fly   141 ESVLKAKAVVAFHRGQYKELYRLLEHHHFSAQNHAKLQALWLKAHYVEAEKLRGRPLGAVGKYRV 205

  Fly   284 RKKYPLPKTIWDGEETVYCFKEKSRNALKDCYLTNRYPTPDEKKTLAKKTGLTLTQVSNWFKNRR 348
            |:|:|||:||||||||.||||||||:.|:|.|..|.||:|.||:.||:.||||.|||||||||||
  Fly   206 RRKFPLPRTIWDGEETSYCFKEKSRSVLRDWYSHNPYPSPREKRDLAEATGLTTTQVSNWFKNRR 270

  Fly   349 QRDR--------TPQQRPDIMSVLPVGQLDGNGFP 375
            ||||        |.:|..|..|   ..:::|:..|
  Fly   271 QRDRAAEHKDGSTDKQHLDSSS---DSEMEGSMLP 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Six4NP_649256.1 SIX1_SD 181..290 CDD:293483 64/108 (59%)
homeodomain 301..355 CDD:238039 39/61 (64%)
soNP_476733.1 SIX1_SD 103..212 CDD:293483 64/108 (59%)
homeodomain 223..274 CDD:238039 36/50 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467665
Domainoid 1 1.000 48 1.000 Domainoid score I4491
eggNOG 1 0.900 - - E1_KOG0775
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I2393
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1040044at2759
OrthoFinder 1 1.000 - - FOG0001063
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10390
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.