DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Six4 and Six5

DIOPT Version :9

Sequence 1:NP_649256.1 Gene:Six4 / 40297 FlyBaseID:FBgn0027364 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001359006.1 Gene:Six5 / 308406 RGDID:1305040 Length:720 Species:Rattus norvegicus


Alignment Length:219 Identity:123/219 - (56%)
Similarity:152/219 - (69%) Gaps:18/219 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 LQFSTDQIQCMCEALQQKGDIEKLTTFLCSLPPSEFFKTNESVLRARAMVAYNLGQFHELYNLLE 243
            |:||.:|:.|:||||.|.|...:|:.||.:|||:|..:.::.||||||:||:..|::.|||.|||
  Rat    76 LRFSPEQVACVCEALLQAGHAGRLSRFLGALPPAERLRGSDPVLRARALVAFQRGEYAELYQLLE 140

  Fly   244 THCFSIKYHVDLQNLWFKAHYKEAEKVRGRPLGAVDKYRLRKKYPLPKTIWDGEETVYCFKEKSR 308
            :..|...:|..||:|:.:|.|.|||:.|||.||||||||||||:||||||||||||||||||:||
  Rat   141 SRPFPAAHHAFLQDLYLRARYHEAERARGRALGAVDKYRLRKKFPLPKTIWDGEETVYCFKERSR 205

  Fly   309 NALKDCYLTNRYPTPDEKKTLAKKTGLTLTQVSNWFKNRRQRDRT------PQQRPDIMSVLPVG 367
            .|||.||..|||||||||:.||..|||:|||||||||||||||||      |.:          .
  Rat   206 AALKACYRGNRYPTPDEKRRLATLTGLSLTQVSNWFKNRRQRDRTGTGGGAPCK----------S 260

  Fly   368 QLDGNGFPRMFNAPSYYPETIFNG 391
            :.|||  |...:..|..||.:..|
  Rat   261 ESDGN--PTTEDESSRSPEDLERG 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Six4NP_649256.1 SIX1_SD 181..290 CDD:293483 58/108 (54%)
homeodomain 301..355 CDD:238039 43/59 (73%)
Six5NP_001359006.1 SIX1_SD 78..187 CDD:374862 58/108 (54%)
homeodomain 198..249 CDD:238039 40/50 (80%)
PHA03247 <414..652 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45655
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10390
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.