DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Six4 and six3b

DIOPT Version :9

Sequence 1:NP_649256.1 Gene:Six4 / 40297 FlyBaseID:FBgn0027364 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_571438.1 Gene:six3b / 30636 ZFINID:ZDB-GENE-990415-128 Length:293 Species:Danio rerio


Alignment Length:189 Identity:105/189 - (55%)
Similarity:137/189 - (72%) Gaps:9/189 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 PIDAKMLQ-----FSTDQIQCMCEALQQKGDIEKLTTFLCSLPPS----EFFKTNESVLRARAMV 228
            |.|..|.|     ||.:|:..:||.|::.||||:|..||.|||.:    :....:||:.||||:|
Zfish    36 PEDLPMFQLPTLNFSAEQVASVCETLEETGDIERLGRFLWSLPVAPGACDAINKHESIQRARAVV 100

  Fly   229 AYNLGQFHELYNLLETHCFSIKYHVDLQNLWFKAHYKEAEKVRGRPLGAVDKYRLRKKYPLPKTI 293
            ||:.|.|.|||::||||.|:...|..||.:|.:|||:||||:||||||.|||||:|||:|||:||
Zfish   101 AYHTGSFRELYHILETHKFTKDSHGKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTI 165

  Fly   294 WDGEETVYCFKEKSRNALKDCYLTNRYPTPDEKKTLAKKTGLTLTQVSNWFKNRRQRDR 352
            ||||:..:||||::|..|::.||.:.||.|.:|:.||:.||||.|||.|||||||||||
Zfish   166 WDGEQKTHCFKERTRGLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDR 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Six4NP_649256.1 SIX1_SD 181..290 CDD:293483 61/112 (54%)
homeodomain 301..355 CDD:238039 32/52 (62%)
six3bNP_571438.1 SIX1_SD 49..162 CDD:293483 61/112 (54%)
homeodomain 170..218 CDD:238039 24/47 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0775
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.