DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Six4 and Six5

DIOPT Version :9

Sequence 1:NP_649256.1 Gene:Six4 / 40297 FlyBaseID:FBgn0027364 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_035513.1 Gene:Six5 / 20475 MGIID:106220 Length:719 Species:Mus musculus


Alignment Length:219 Identity:123/219 - (56%)
Similarity:152/219 - (69%) Gaps:18/219 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 LQFSTDQIQCMCEALQQKGDIEKLTTFLCSLPPSEFFKTNESVLRARAMVAYNLGQFHELYNLLE 243
            |:||.:|:.|:||||.|.|...:|:.||.:|||:|..:.::.||||||:||:..|::.|||.|||
Mouse    77 LRFSPEQVACVCEALLQAGHAGRLSRFLGALPPAERLRGSDPVLRARALVAFQRGEYAELYQLLE 141

  Fly   244 THCFSIKYHVDLQNLWFKAHYKEAEKVRGRPLGAVDKYRLRKKYPLPKTIWDGEETVYCFKEKSR 308
            :..|...:|..||:|:.:|.|.|||:.|||.||||||||||||:||||||||||||||||||:||
Mouse   142 SRPFPAAHHAFLQDLYLRARYHEAERARGRALGAVDKYRLRKKFPLPKTIWDGEETVYCFKERSR 206

  Fly   309 NALKDCYLTNRYPTPDEKKTLAKKTGLTLTQVSNWFKNRRQRDRT------PQQRPDIMSVLPVG 367
            .|||.||..|||||||||:.||..|||:|||||||||||||||||      |.:          .
Mouse   207 AALKACYRGNRYPTPDEKRRLATLTGLSLTQVSNWFKNRRQRDRTGTGGGAPCK----------S 261

  Fly   368 QLDGNGFPRMFNAPSYYPETIFNG 391
            :.|||  |...:..|..||.:..|
Mouse   262 ESDGN--PTTEDESSRSPEDLERG 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Six4NP_649256.1 SIX1_SD 181..290 CDD:293483 58/108 (54%)
homeodomain 301..355 CDD:238039 43/59 (73%)
Six5NP_035513.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..73
SIX1_SD 79..188 CDD:293483 58/108 (54%)
homeodomain 199..250 CDD:238039 40/50 (80%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 241..287 20/55 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0775
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43583
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10390
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5881
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.900

Return to query results.
Submit another query.