DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Six4 and Six4

DIOPT Version :9

Sequence 1:NP_649256.1 Gene:Six4 / 40297 FlyBaseID:FBgn0027364 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_035512.1 Gene:Six4 / 20474 MGIID:106034 Length:775 Species:Mus musculus


Alignment Length:277 Identity:136/277 - (49%)
Similarity:170/277 - (61%) Gaps:34/277 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 SPPPTASTTPTHYPSLNSIIFENGSSGNLGDLNGNTKTDLCAGLQRSGGGLGGNAGSGGHLISNL 160
            |||     .|..:|      .|.|.:.            ..:.:.|..|.....|.....|.|.|
Mouse    44 SPP-----APAPFP------LEPGDAA------------AASRVSREEGAAAAGAADQVQLHSEL 85

  Fly   161 TAAHNMSAVSSFPIDAKMLQFSTDQIQCMCEALQQKGDIEKLTTFLCSLPPSEFFKTNESVLRAR 225
            ...|..:|.:..|     |.||.|.:.|:||||||.|::::|..||.|||.|:..:.|||:|:||
Mouse    86 LGRHQHAAAAQPP-----LAFSPDHVACVCEALQQGGNLDRLARFLWSLPQSDLLRGNESLLKAR 145

  Fly   226 AMVAYNLGQFHELYNLLETHCFSIKYHVDLQNLWFKAHYKEAEKVRGRPLGAVDKYRLRKKYPLP 290
            |:||::.|.:.|||::||:|.|....|..||.||:||.|.|||:.||||||||||||||:|:|||
Mouse   146 ALVAFHQGIYPELYSILESHSFESANHPLLQQLWYKARYTEAERARGRPLGAVDKYRLRRKFPLP 210

  Fly   291 KTIWDGEETVYCFKEKSRNALKDCYLTNRYPTPDEKKTLAKKTGLTLTQVSNWFKNRRQRDRTPQ 355
            :|||||||||||||||||||||:.|..||||:|.||:.|||.|||:||||||||||||||||.|.
Mouse   211 RTIWDGEETVYCFKEKSRNALKELYKQNRYPSPAEKRHLAKITGLSLTQVSNWFKNRRQRDRNPS 275

  Fly   356 QRPDIMSVLPVGQLDGN 372
            :...      ..:.|||
Mouse   276 ETQS------KSESDGN 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Six4NP_649256.1 SIX1_SD 181..290 CDD:293483 62/108 (57%)
homeodomain 301..355 CDD:238039 42/53 (79%)
Six4NP_035512.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..76 7/31 (23%)
SIX1_SD 101..210 CDD:293483 47/108 (44%)
homeodomain 221..275 CDD:238039 44/53 (83%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 263..313 31/49 (63%)
Transactivation domain 582..775
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848461
Domainoid 1 1.000 88 1.000 Domainoid score I7952
eggNOG 1 0.900 - - E1_KOG0775
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43583
orthoMCL 1 0.900 - - OOG6_109892
Panther 1 1.100 - - O PTHR10390
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3257
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.700

Return to query results.
Submit another query.