DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Six4 and ceh-33

DIOPT Version :9

Sequence 1:NP_649256.1 Gene:Six4 / 40297 FlyBaseID:FBgn0027364 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_504420.1 Gene:ceh-33 / 191622 WormBaseID:WBGene00000454 Length:261 Species:Caenorhabditis elegans


Alignment Length:179 Identity:95/179 - (53%)
Similarity:131/179 - (73%) Gaps:2/179 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 QFSTDQIQCMCEALQQKGDIEKLTTFLCSLPPSEFFKTNESVLRARAMVAYNLGQFHELYNLLET 244
            ::|.:|:.|:||||  ..|..||:.|:.::...:..:.|:.:|:|:|.:|::...|.|||.::|:
 Worm    19 RYSEEQVACICEAL--SNDARKLSQFVWTVLERDEMRNNQYILKAQAFLAFHSNNFKELYRIIES 81

  Fly   245 HCFSIKYHVDLQNLWFKAHYKEAEKVRGRPLGAVDKYRLRKKYPLPKTIWDGEETVYCFKEKSRN 309
            |.|:.::|:.||..|..|||.||||:|||.||||.|||:|:|||||:||||||||.|||::|||.
 Worm    82 HHFASEHHLPLQEWWLNAHYHEAEKIRGRQLGAVGKYRIRRKYPLPRTIWDGEETSYCFRDKSRV 146

  Fly   310 ALKDCYLTNRYPTPDEKKTLAKKTGLTLTQVSNWFKNRRQRDRTPQQRP 358
            .|:|.|..|.||:|.||:.||:||.||:|||||||||||||||.....|
 Worm   147 LLRDWYCRNSYPSPREKRELAEKTHLTVTQVSNWFKNRRQRDRAGVPEP 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Six4NP_649256.1 SIX1_SD 181..290 CDD:293483 48/108 (44%)
homeodomain 301..355 CDD:238039 36/53 (68%)
ceh-33NP_504420.1 SIX1_SD 20..127 CDD:293483 48/108 (44%)
homeodomain 138..189 CDD:238039 34/50 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0775
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001063
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.770

Return to query results.
Submit another query.