DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Six4 and ceh-32

DIOPT Version :9

Sequence 1:NP_649256.1 Gene:Six4 / 40297 FlyBaseID:FBgn0027364 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_505958.1 Gene:ceh-32 / 179603 WormBaseID:WBGene00000453 Length:439 Species:Caenorhabditis elegans


Alignment Length:267 Identity:112/267 - (41%)
Similarity:157/267 - (58%) Gaps:22/267 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 TPTHYPSLNSIIFENGSSGNLGDLNGNTKTDLCAGLQRSGGGLGGNAGSGGHLISNLTAAHNMSA 168
            ||..:   ..::.:.|:...||.:.......:...||.:|      |.|...|...:.:.....|
 Worm     3 TPEQF---TKVMSQLGNFSQLGQMFQPGNVAMLQALQANG------ASSTPSLFPAMPSVIPSLA 58

  Fly   169 VSSFPIDAKMLQFSTDQIQCMCEALQQKGDIEKLTTFLCSLPPSEFFKT-----NESVLRARAMV 228
            ..|.|..:.:   :.|||...||.|:..||::.|..|:|::||.   ||     ||:.|||||:|
 Worm    59 APSSPTTSNL---TADQIVKTCEQLETDGDVDGLFRFMCTIPPQ---KTQEVAGNEAFLRARALV 117

  Fly   229 AYNLGQFHELYNLLETHCFSIKYHVDLQNLWFKAHYKEAEKVRGRPLGAVDKYRLRKKYPLPKTI 293
            .::...|.|||.:||.:.||.|||..||.:|.:|||:|.||.||:.|.||||||:|||||:|:||
 Worm   118 CFHASHFRELYAILENNKFSPKYHPKLQEMWHEAHYREQEKNRGKSLCAVDKYRVRKKYPMPRTI 182

  Fly   294 WDGEETVYCFKEKSRNALKDCYLTNRYPTPDEKKTLAKKTGLTLTQVSNWFKNRRQRDR--TPQQ 356
            ||||:..:||||::|:.|::.||.:.||.|.:||.||..||||..||.|||||||||||  ..:.
 Worm   183 WDGEQKTHCFKERTRSLLREWYLKDPYPNPPKKKELANATGLTQMQVGNWFKNRRQRDRAAAAKN 247

  Fly   357 RPDIMSV 363
            :.:|:.|
 Worm   248 KQNIIGV 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Six4NP_649256.1 SIX1_SD 181..290 CDD:293483 57/113 (50%)
homeodomain 301..355 CDD:238039 32/55 (58%)
ceh-32NP_505958.1 SIX1_SD 68..179 CDD:293483 57/116 (49%)
homeodomain 187..236 CDD:238039 25/48 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 118 1.000 Domainoid score I3665
eggNOG 1 0.900 - - E1_KOG0775
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.