DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Six4 and ceh-34

DIOPT Version :9

Sequence 1:NP_649256.1 Gene:Six4 / 40297 FlyBaseID:FBgn0027364 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_504419.1 Gene:ceh-34 / 178919 WormBaseID:WBGene00000455 Length:256 Species:Caenorhabditis elegans


Alignment Length:237 Identity:100/237 - (42%)
Similarity:131/237 - (55%) Gaps:46/237 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 FSTDQIQCMCEAL----QQKGDIEKLTTFLCSLPPSEFFKTNESVLRARAMVAYNLGQFHELYNL 241
            :|..:|.|:||:|    .|.|..|:|..|:.:||  :.::..||||:|:|:|.:....:..||.|
 Worm    17 YSEQEIVCICESLFNEGLQTGRTEQLANFIYNLP--QCYQVMESVLKAQALVYFTTQNWKMLYKL 79

  Fly   242 LETHCFSIKYHVDLQNLWFKAHYKEAEKVRGRPLGAVDKYRLRKKYPLPKTIWDGEETVYCFKEK 306
            ||...||...|..|||||..||||||.|.:.|.||||.|||:|||.|.|.||||||||.||||.|
 Worm    80 LECSKFSPHNHTVLQNLWLDAHYKEAAKTKDRELGAVCKYRIRKKNPFPNTIWDGEETNYCFKSK 144

  Fly   307 SRNALKDCYLTNRYPTPDEKKTLAKKTGLTLTQVSNWFKNRRQRDRTPQQRPDIMSVLPVGQLDG 371
            |||.|:|.|...:||:.::|:.||::|.|::.||||||||:|||:|.            .||||.
 Worm   145 SRNVLRDAYKKCQYPSVEDKRRLAQQTELSIIQVSNWFKNKRQRERA------------AGQLDR 197

  Fly   372 NG----------------------------FPRMFNAPSYYP 385
            :.                            .|..|:...|||
 Worm   198 SSARSNDSDDGSSGCESKPPMNIDSPAPPPLPTSFDLQPYYP 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Six4NP_649256.1 SIX1_SD 181..290 CDD:293483 52/112 (46%)
homeodomain 301..355 CDD:238039 30/53 (57%)
ceh-34NP_504419.1 SIX1_SD 17..128 CDD:293483 52/112 (46%)
homeodomain 139..190 CDD:238039 29/50 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167553
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0775
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001063
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5881
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.730

Return to query results.
Submit another query.