DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Six4 and Six1

DIOPT Version :9

Sequence 1:NP_649256.1 Gene:Six4 / 40297 FlyBaseID:FBgn0027364 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_446211.1 Gene:Six1 / 114634 RGDID:620906 Length:284 Species:Rattus norvegicus


Alignment Length:192 Identity:113/192 - (58%)
Similarity:141/192 - (73%) Gaps:7/192 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 MSAVSSFPIDAKMLQFSTDQIQCMCEALQQKGDIEKLTTFLCSLPPSEFFKTNESVLRARAMVAY 230
            ||.:.||       .|:.:|:.|:||.|||.|::|:|..||.|||..:....|||||:|:|:||:
  Rat     1 MSMLPSF-------GFTQEQVACVCEVLQQGGNLERLGRFLWSLPACDHLHKNESVLKAKAVVAF 58

  Fly   231 NLGQFHELYNLLETHCFSIKYHVDLQNLWFKAHYKEAEKVRGRPLGAVDKYRLRKKYPLPKTIWD 295
            :.|.|.|||.:||:|.||...|..||.||.||||.||||:||||||||.|||:|:|:|||:||||
  Rat    59 HRGNFRELYKILESHQFSPHNHPKLQQLWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWD 123

  Fly   296 GEETVYCFKEKSRNALKDCYLTNRYPTPDEKKTLAKKTGLTLTQVSNWFKNRRQRDRTPQQR 357
            ||||.||||||||..|::.|..|.||:|.||:.||:.||||.|||||||||||||||..:.:
  Rat   124 GEETSYCFKEKSRGVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAK 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Six4NP_649256.1 SIX1_SD 181..290 CDD:293483 62/108 (57%)
homeodomain 301..355 CDD:238039 37/53 (70%)
Six1NP_446211.1 SIX1_SD 9..118 CDD:407119 62/108 (57%)
homeodomain 129..180 CDD:238039 35/50 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0775
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001063
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.