DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nhlh2 and CG33557

DIOPT Version :9

Sequence 1:NP_991232.1 Gene:nhlh2 / 402968 ZFINID:ZDB-GENE-040426-1809 Length:122 Species:Danio rerio
Sequence 2:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster


Alignment Length:75 Identity:31/75 - (41%)
Similarity:42/75 - (56%) Gaps:4/75 - (5%)


- Green bases have known domain annotations that are detailed below.


Zfish    47 PAALTREEKRRRRRATAKYRSAHATRERIRVEAFNVAFAELRKLLPTLPPDKKLSKIEILRLAIC 111
            |.....:...|||....|..:    |||.|....|.|:..||.|:||.|.::|||||||:|||..
  Fly    48 PGGQENQGNHRRRPPRQKINA----RERYRTFNVNSAYEALRNLIPTEPMNRKLSKIEIIRLASS 108

Zfish   112 YISYLNHVLD 121
            ||::|:..|:
  Fly   109 YITHLSSTLE 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nhlh2NP_991232.1 HLH 66..116 CDD:278439 24/49 (49%)
CG33557NP_001014730.1 HLH 67..119 CDD:197674 26/56 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.