DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex14 and Pex14

DIOPT Version :9

Sequence 1:NP_649253.1 Gene:Pex14 / 40294 FlyBaseID:FBgn0037020 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_742060.1 Gene:Pex14 / 64460 RGDID:68336 Length:376 Species:Rattus norvegicus


Alignment Length:284 Identity:84/284 - (29%)
Similarity:138/284 - (48%) Gaps:56/284 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GVDEQLPRESLITTAVSFLQNTKVRHTTLIQKQQFLRSKGLTAHEIQLACERAGVFTQDPNKPNP 91
            |.:..:|||.||.|||.||||::||.:.|..::.||:.||||..||.||.:::|..:.:|:...|
  Rat    18 GSENVVPREPLIATAVKFLQNSRVRQSPLATRRAFLKKKGLTDEEIDLAFQQSGTASDEPSPVGP 82

  Fly    92 -------NPNTVISIGSQLHALQPQPTVLGRIREIIHSAALFSGVVYAVYIFWKQYIAPYLF-GK 148
                   .|..:||        ||......|.|:....|.:.:|:.:..:..:|:|:.|.:. |:
  Rat    83 ATPVVPVQPPHLIS--------QPYSPGGSRWRDYGALAIILAGIAFGFHQLYKKYLLPLILGGR 139

  Fly   149 SKKKAVDEV---LDDIDKKVETRTNDLNKEILAVRDLITTQQREHAQQLNRE------------- 197
            ..:|.::.:   |.::...|......:...:.:|::|: .||::..|:|..|             
  Rat   140 EDRKQLERMAASLSELSGSVAQTVTQVQTTLASVQELL-RQQQQKVQELAHELAAAKATTSTNWI 203

  Fly   198 -----FSNFRSDLDAIKGLLLNRKQFAGPVAPIAVPSIPAWQL------AGSPHHHHRHSGSD-- 249
                 .:..:|:::::|||||||:||  |.:|.| |.||:||:      ..||...:.||.||  
  Rat   204 LESQNINELKSEINSLKGLLLNRRQF--PPSPSA-PKIPSWQIPVKSPSPSSPAAVNHHSSSDIS 265

  Fly   250 --DNEK-----GDDAGSGSGSSET 266
              .||.     |.|..|..||:.|
  Rat   266 PVSNESPSSSPGKDGHSPEGSTAT 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex14NP_649253.1 Pex14_N 34..145 CDD:282540 39/117 (33%)
Pex14NP_742060.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23 1/4 (25%)
Pex14_N 25..135 CDD:282540 38/116 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 70..93 6/29 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 230..376 13/37 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353297
Domainoid 1 1.000 66 1.000 Domainoid score I9772
eggNOG 1 0.900 - - E1_KOG2629
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37936
Inparanoid 1 1.050 108 1.000 Inparanoid score I4812
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1033073at2759
OrthoFinder 1 1.000 - - FOG0004737
OrthoInspector 1 1.000 - - oto98635
orthoMCL 1 0.900 - - OOG6_105746
Panther 1 1.100 - - LDO PTHR23058
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.760

Return to query results.
Submit another query.