DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex14 and prx-14

DIOPT Version :9

Sequence 1:NP_649253.1 Gene:Pex14 / 40294 FlyBaseID:FBgn0037020 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_502097.1 Gene:prx-14 / 178026 WormBaseID:WBGene00004199 Length:258 Species:Caenorhabditis elegans


Alignment Length:224 Identity:62/224 - (27%)
Similarity:103/224 - (45%) Gaps:34/224 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RESLITTAVSFLQNTKVRHTTLIQKQQFLRSKGLTAHEIQLACERAGVFTQDPNKPNPNPNT--V 96
            |..::..|..|:...||:.|...:::|||..||::..||..|  ||.:   .|.:......|  :
 Worm    10 RPDMVEAARKFMLTPKVKETPFEEQRQFLLGKGVSEAEILEA--RASI---PPEQLRSQIGTENM 69

  Fly    97 ISIGSQLHALQPQPTVLGRIREII---HSAALFSGVVYAVYIFWKQYIAPYLFGKSKKKAVDEVL 158
            |.||.     .||..:..:...|:   .||.:...:.||.|.|.:.|:.|..|     ...|...
 Worm    70 IPIGG-----HPQMMIAPKQNGIVSFAQSAVVLGSISYAGYRFVRSYVLPRFF-----DIPDPAT 124

  Fly   159 DDIDKKVETRTNDLNKEILAVRDLIT-------TQQREHAQQL----NR--EFSNFRSDLDAIKG 210
            ::| ::::::.:||...|..:.|.::       |||.|.::.|    ||  :.:...|.:..||.
 Worm   125 EEI-RQLQSQVDDLQNSIKFIMDSVSQTTQQLATQQSEISRALYSVANRDADLNRVESGISTIKS 188

  Fly   211 LLLNRKQFAGPVAPIAVPSIPAWQLAGSP 239
            |||::..||..|.|....|||:||.:.:|
 Worm   189 LLLSQHNFAPIVTPSVTSSIPSWQQSATP 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex14NP_649253.1 Pex14_N 34..145 CDD:282540 32/115 (28%)
prx-14NP_502097.1 Pex14_N 10..>58 CDD:368060 16/52 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166857
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2629
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I3943
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28736
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004737
OrthoInspector 1 1.000 - - oto19224
orthoMCL 1 0.900 - - OOG6_105746
Panther 1 1.100 - - LDO PTHR23058
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R901
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.830

Return to query results.
Submit another query.