DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex14 and pex14

DIOPT Version :9

Sequence 1:NP_649253.1 Gene:Pex14 / 40294 FlyBaseID:FBgn0037020 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_002939456.1 Gene:pex14 / 100489925 XenbaseID:XB-GENE-993111 Length:362 Species:Xenopus tropicalis


Alignment Length:290 Identity:86/290 - (29%)
Similarity:148/290 - (51%) Gaps:49/290 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 MATATSVQNDVEAG---VDEQ-LPRESLITTAVSFLQNTKVRHTTLIQKQQFLRSKGLTAHEIQL 74
            ||::......|::|   ::|: :||:.||.|||.||||.:||.:.:..:::||:.|||:..||:|
 Frog     1 MASSDQADQSVQSGPSLINEKTVPRDQLIATAVKFLQNPRVRQSPVATRKEFLKKKGLSNEEIEL 65

  Fly    75 ACERAGVFTQDPNK------PNPNPNTVISIGSQLHALQPQPTVLGRIREIIHSAALFSGVVYAV 133
            |.:::|....||..      |:..|:      |||...|..|.. .|.||....|.:.:|:.:..
 Frog    66 ALQQSGTAHDDPGLMTHTVIPHSGPS------SQLAVQQFSPPG-SRWREYGALAIILAGIAFGF 123

  Fly   134 YIFWKQYIAPYLFG--KSKK--KAVDEVLDDIDKKVETRTNDLNKEILAVRDLITTQQREHAQQL 194
            :..:|:|:.|.:.|  :|:|  :.::..:.::...|......|...:.||::|: .||::..|:|
 Frog   124 HQLYKRYLLPLIIGGRESRKQLQRIESGVSEMSGSVTQTVTQLQTTLAAVQELL-IQQQQKIQEL 187

  Fly   195 NREFS------------------NFRSDLDAIKGLLLNRKQFAGPVAPIAVPSIPAWQL------ 235
            :.|.|                  ..:|::.::|||||||:||  |.:|.| ..|||||:      
 Frog   188 SLELSASKASSSTNTILESQNIQELKSEIYSLKGLLLNRRQF--PPSPSA-SKIPAWQIPVKPPT 249

  Fly   236 AGSPHHHHRHSGSDDNEKGDDAGSGSGSSE 265
            ..||...:.:|.||.:...:::||.|...|
 Frog   250 LPSPAVLNHNSSSDISPVSNESGSSSPVKE 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex14NP_649253.1 Pex14_N 34..145 CDD:282540 39/116 (34%)
pex14XP_002939456.1 Pex14_N 25..135 CDD:368060 39/116 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H37936
Inparanoid 1 1.050 105 1.000 Inparanoid score I4806
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1033073at2759
OrthoFinder 1 1.000 - - FOG0004737
OrthoInspector 1 1.000 - - oto105330
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R901
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.090

Return to query results.
Submit another query.