DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex16 and SSE1

DIOPT Version :9

Sequence 1:NP_649252.1 Gene:Pex16 / 40293 FlyBaseID:FBgn0037019 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_566053.1 Gene:SSE1 / 819177 AraportID:AT2G45690 Length:367 Species:Arabidopsis thaliana


Alignment Length:385 Identity:88/385 - (22%)
Similarity:162/385 - (42%) Gaps:75/385 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LKAYEAWVGKNPDVVGDFETTAKWVSYFIAGRISSSNVVSELVYTLSNMLVFYNDRIIEKARNSE 72
            ::||:.||.:|.:.|..|.:.|..:::.:..:.|:|.:..|.|.....:....|:.|||.|....
plant     1 MEAYKQWVWRNREYVQSFGSFANGLTWLLPEKFSASEIGPEAVTAFLGIFSTINEHIIENAPTPR 65

  Fly    73 ENSVIHLQS-----KLCYRLKVTLTTLEYSEVFIEISARRLFGQSGKWLVIALIQAFKAAGRFFI 132
            .    |:.|     .|.|.|.:.:  |:..|..:|::|...:|.. ||..|.|.:|.||..|..:
plant    66 G----HVGSSGNDPSLSYPLLIAI--LKDLETVVEVAAEHFYGDK-KWNYIILTEAMKAVIRLAL 123

  Fly   133 LKHSTSDII-----------TSPPIAALNRRAKQRKNSG-DGVASSTNDLLQSQHS-------IT 178
            .::|...::           .|....:.||.....:|.| .|:.:      |:.|:       ..
plant   124 FRNSGYKMLLQGGETPNEEKDSNQSESQNRAGNSGRNLGPHGLGN------QNHHNPWNLEGRAM 182

  Fly   179 FQLKRSGRVIRKVEGAPPLQYRDFKLHIDNNEAA--------KTQIPRKLLQ-----------AE 224
            ..|...|:..|....:.|    .:...|.:.:|.        :.:...:||.           .|
plant   183 SALSSFGQNARTTTSSTP----GWSRRIQHQQAVIEPPMIKERRRTMSELLTEKGVNGALFAIGE 243

  Fly   225 YLYISKPLIHLVAMGLFGRRSWKQYMVALSIDLYSIHLYRQHR--DLMSKQ------QKLELSRR 281
            .|||::|||:::.:..:|.|||..:.::||:|...:.|....:  ...|||      :|.||.||
plant   244 VLYITRPLIYVLFIRKYGVRSWIPWAISLSVDTLGMGLLANSKWWGEKSKQVHFSGPEKDELRRR 308

  Fly   282 CINIMYFLVRSPFYDSFTKSRLE---RILDFVATSVPIAKVVAKPLKDYIPTWQSTYFYL 338
            .:....:|:|.||:..:|:.:||   :.|:.    :|:...:.:.:.:.:...||.|.|:
plant   309 KLIWALYLMRDPFFTKYTRQKLESSQKKLEL----IPLIGFLTEKIVELLEGAQSRYTYI 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex16NP_649252.1 Pex16 11..333 CDD:285774 83/375 (22%)
SSE1NP_566053.1 Pex16 4..359 CDD:285774 83/375 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 74 1.000 Domainoid score I3260
eggNOG 1 0.900 - - E1_KOG4546
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I2410
OMA 1 1.010 - - QHG58411
OrthoDB 1 1.010 - - D908842at2759
OrthoFinder 1 1.000 - - FOG0006249
OrthoInspector 1 1.000 - - oto3265
orthoMCL 1 0.900 - - OOG6_103805
Panther 1 1.100 - - LDO PTHR13299
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.840

Return to query results.
Submit another query.