DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pitslre and SGV1

DIOPT Version :9

Sequence 1:NP_649251.2 Gene:Pitslre / 40292 FlyBaseID:FBgn0016696 Length:952 Species:Drosophila melanogaster
Sequence 2:NP_015487.1 Gene:SGV1 / 856290 SGDID:S000006365 Length:657 Species:Saccharomyces cerevisiae


Alignment Length:464 Identity:152/464 - (32%)
Similarity:234/464 - (50%) Gaps:76/464 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   486 EVDRQDVGADASPSSSTRSEERGMTQEQPEEKPEEKLKEKQKSLEEQIPCDDKGIPLPNYYPGVQ 550
            |.::..:|...|..:..|..:..:|.          :|.:::|.|:...|    ....|:|    
Yeast    14 EFNKYKIGKVKSTPAIQRDAKTNLTY----------IKLRKRSSEKVYGC----TVFQNHY---- 60

  Fly   551 GCRSVEEFQCLNRIEEGTYGVVYRAKDKRTNEIVALKRLKMEKEKEGFPITSLREINTLLKGQHP 615
              |..|      ::.:||:|.||:.....|...||:|::.:..||:.||||:.|||..|.:..|.
Yeast    61 --REDE------KLGQGTFGEVYKGIHLETQRQVAMKKIIVSVEKDLFPITAQREITILKRLNHK 117

  Fly   616 NIVTVREIV----------VGSNMDKIF-IVMDYVEHDLKSLMETMKNRKQSFFPGEVKCLTQQL 669
            ||:.:.|:|          ..||:.|.| :::.|:..||..::.   |.:.:....::|.:..|:
Yeast   118 NIIKLIEMVYDHSPDITNAASSNLHKSFYMILPYMVADLSGVLH---NPRINLEMCDIKNMMLQI 179

  Fly   670 LRAVAHLHDNWILHRDLKTSNLLLSHKGILKVGDFGLAR-EYGSP--IK---------KYTSLVV 722
            |..:.::|....:|||:||:|:|:.|.|:||:.|||||| .||.|  :|         ||||:||
Yeast   180 LEGLNYIHCAKFMHRDIKTANILIDHNGVLKLADFGLARLYYGCPPNLKYPGGAGSGAKYTSVVV 244

  Fly   723 TLWYRAPELLLCSPVYSTPIDVWSVGCIFAEFLQMLPLFPGKSEIDELNRIFKELGTPNEKIWPG 787
            |.|||||||:|....|:|.:|:|.|||:||||.:..|:..||::||:.:.|||.||||.|:.|..
Yeast   245 TRWYRAPELVLGDKQYTTAVDIWGVGCVFAEFFEKKPILQGKTDIDQGHVIFKLLGTPTEEDWAV 309

  Fly   788 YTELPAVKNMLSQNSQFTEYPVSQLRKHFQEKTSEMGLSLLQGLLTYDPKQRLSADAALKHGFFK 852
            ...||..: :.:.|.:.|      ||:.|.:..||.||..|..||..||.:||:|.:|..|.:||
Yeast   310 ARYLPGAE-LTTTNYKPT------LRERFGKYLSETGLDFLGQLLALDPYKRLTAMSAKHHPWFK 367

  Fly   853 ELPLPIDPSMFPTWPA--------KSELGARKAQASSPKPPSGGSQFKQLGRDEPIIVGPGNKLS 909
            |.|||.:....||..:        |.|:....:| ..|..|.|  ...:.| :.|::...|    
Yeast   368 EDPLPSEKITLPTEESHEADIKRYKEEMHQSLSQ-RVPTAPRG--HIVEKG-ESPVVKNLG---- 424

  Fly   910 SGIITGNKK 918
             .|..|.||
Yeast   425 -AIPRGPKK 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PitslreNP_649251.2 STKc_CDC2L1 552..851 CDD:173741 120/321 (37%)
PLN00009 555..854 CDD:177649 121/321 (38%)
SGV1NP_015487.1 STKc_BUR1 50..366 CDD:270849 123/341 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.