DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pitslre and ZNF84

DIOPT Version :9

Sequence 1:NP_649251.2 Gene:Pitslre / 40292 FlyBaseID:FBgn0016696 Length:952 Species:Drosophila melanogaster
Sequence 2:NP_001120844.1 Gene:ZNF84 / 7637 HGNCID:13159 Length:738 Species:Homo sapiens


Alignment Length:202 Identity:43/202 - (21%)
Similarity:65/202 - (32%) Gaps:59/202 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   748 GCIFAEFLQMLPLFP----GKSEIDELN---RIFKELGTPNEKIWPGYTELPAVKN-------ML 798
            |.|....|.:  |.|    ||:|.|:.|   ..|......:...|..|.:....|.       ::
Human   134 GLILKHHLDL--LIPKGDYGKAESDDFNVFDNFFLHSKPEDTDTWLKYYDCDKYKESYKKSQIII 196

  Fly   799 SQNSQFTE--YPVSQLRKHFQEKTSEMGLSLLQGLLTYDPKQRLSADAALKHGFFKELPLPIDPS 861
            ...::..|  |..|:.||.|.:|.|         |:.:  :.|...|.|...|           :
Human   197 YHRNRLGEKLYECSECRKRFSKKPS---------LIKH--QSRHIRDIAFGCG-----------N 239

  Fly   862 MFPTWPAKSELGARKAQASSPKP---PSGGSQFKQLGR----------DEPIIVGPGNKLSSGII 913
            ...|:|.||:........:..||   ...|..|.|..:          ::|...|...|..|   
Human   240 CGKTFPQKSQFITHHRTHTGEKPYNCSQCGKAFSQKSQLTSHQRTHTGEKPYECGECGKAFS--- 301

  Fly   914 TGNKKSH 920
               :|||
Human   302 ---RKSH 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PitslreNP_649251.2 STKc_CDC2L1 552..851 CDD:173741 27/118 (23%)
PLN00009 555..854 CDD:177649 27/121 (22%)
ZNF84NP_001120844.1 KRAB 9..68 CDD:214630
C2H2 Zn finger 209..229 CDD:275368 7/30 (23%)
C2H2 Zn finger 237..257 CDD:275368 5/30 (17%)
C2H2 Zn finger 265..285 CDD:275368 3/19 (16%)
zf-H2C2_2 278..302 CDD:316026 4/29 (14%)
C2H2 Zn finger 293..313 CDD:275368 6/19 (32%)
COG5048 317..724 CDD:227381
C2H2 Zn finger 321..341 CDD:275368
C2H2 Zn finger 349..369 CDD:275368
C2H2 Zn finger 377..397 CDD:275368
C2H2 Zn finger 405..425 CDD:275368
C2H2 Zn finger 433..453 CDD:275368
C2H2 Zn finger 461..481 CDD:275368
C2H2 Zn finger 489..509 CDD:275368
C2H2 Zn finger 517..537 CDD:275368
C2H2 Zn finger 545..565 CDD:275368
C2H2 Zn finger 573..593 CDD:275368
C2H2 Zn finger 601..621 CDD:275368
C2H2 Zn finger 629..649 CDD:275368
C2H2 Zn finger 657..677 CDD:275368
C2H2 Zn finger 685..705 CDD:275368
C2H2 Zn finger 713..733 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.