powered by:
Protein Alignment Pitslre and ZNF26
DIOPT Version :9
Sequence 1: | NP_649251.2 |
Gene: | Pitslre / 40292 |
FlyBaseID: | FBgn0016696 |
Length: | 952 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_016875409.1 |
Gene: | ZNF26 / 7574 |
HGNCID: | 13053 |
Length: | 575 |
Species: | Homo sapiens |
Alignment Length: | 130 |
Identity: | 28/130 - (21%) |
Similarity: | 43/130 - (33%) |
Gaps: | 58/130 - (44%) |
- Green bases have known domain annotations that are detailed below.
Fly 348 LNIHVKRKSKPDNYEKEIKLKKRREDDIEVIRDDDDEESEESDSNEEVPEQDSEGSATESGSEDS 412
:|..:.|:|.||.:| :..:..:|::|.| |.|
Human 117 INAKISRQSCPDGWE---EWYQNNQDELESI-------------------------------ERS 147
Fly 413 YASKKKSKIK-SKSQLEDDDEDLPLPDSPLSVGELYKSPKQRQRSRSVSSKSSSQSSRSSRSRSR 476
||.....::. ||:. || .|||..:...||.:|:|..|||..|
Human 148 YACSVLGRLNLSKTH-----------DS------------SRQRLYNTRGKSLTQNSAPSRSYLR 189
Fly 477 476
Human 190 189
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Pitslre | NP_649251.2 |
STKc_CDC2L1 |
552..851 |
CDD:173741 |
|
PLN00009 |
555..854 |
CDD:177649 |
|
ZNF26 | XP_016875409.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
0 | 0.000 |
|
Return to query results.
Submit another query.