DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pitslre and ZNF26

DIOPT Version :9

Sequence 1:NP_649251.2 Gene:Pitslre / 40292 FlyBaseID:FBgn0016696 Length:952 Species:Drosophila melanogaster
Sequence 2:XP_016875409.1 Gene:ZNF26 / 7574 HGNCID:13053 Length:575 Species:Homo sapiens


Alignment Length:130 Identity:28/130 - (21%)
Similarity:43/130 - (33%) Gaps:58/130 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   348 LNIHVKRKSKPDNYEKEIKLKKRREDDIEVIRDDDDEESEESDSNEEVPEQDSEGSATESGSEDS 412
            :|..:.|:|.||.:|   :..:..:|::|.|                               |.|
Human   117 INAKISRQSCPDGWE---EWYQNNQDELESI-------------------------------ERS 147

  Fly   413 YASKKKSKIK-SKSQLEDDDEDLPLPDSPLSVGELYKSPKQRQRSRSVSSKSSSQSSRSSRSRSR 476
            ||.....::. ||:.           ||            .|||..:...||.:|:|..|||..|
Human   148 YACSVLGRLNLSKTH-----------DS------------SRQRLYNTRGKSLTQNSAPSRSYLR 189

  Fly   477  476
            Human   190  189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PitslreNP_649251.2 STKc_CDC2L1 552..851 CDD:173741
PLN00009 555..854 CDD:177649
ZNF26XP_016875409.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.