DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pitslre and CG6800

DIOPT Version :9

Sequence 1:NP_649251.2 Gene:Pitslre / 40292 FlyBaseID:FBgn0016696 Length:952 Species:Drosophila melanogaster
Sequence 2:NP_650984.1 Gene:CG6800 / 42562 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster


Alignment Length:311 Identity:101/311 - (32%)
Similarity:166/311 - (53%) Gaps:36/311 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   542 LPNYYPGVQGCRSVEEFQCLNRIEEGTYGVVYRAKDKRTNEIVALKRLKMEKEKEGFPITSLREI 606
            :.:|.|        ..::.|.:|.||.:|.|::|.|.:.|:.||:|::.::.:.....:.:||||
  Fly     1 MEDYAP--------SRYKMLEKIGEGVHGCVFKAIDLQRNKEVAIKKVALKNKFGNIALNTLREI 57

  Fly   607 NTLLKGQHPNIVTVREIVVGSNMDKIFIVMDYVEHDLKSLMETMKNRKQSFFPGEVKCLTQQLLR 671
            .||...:...|:.:.:|.  .::..:.:|::|..       :|:.||.:|    ||..|::|.:|
  Fly    58 KTLQLCKSEYILDIIDIY--PDLTGLSLVLEYQP-------DTLYNRLKS----EVNPLSRQQVR 109

  Fly   672 AVAH--------LHDNWILHRDLKTSNLLLSHKGILKVGDFGLAREY--GSPIKKYTSLVVTLWY 726
            ..||        ||:..::|||:|.:|||:|...:||:.||||||.|  ....:.|:..|.|.||
  Fly   110 KFAHQMFKGIAYLHEAGLMHRDIKPANLLISDTDMLKIADFGLARLYFPEDESRLYSPQVSTRWY 174

  Fly   727 RAPELLLCSPVYSTPIDVWSVGCIFAEFLQMLPLFPGKSEIDELNRIFKELGTPNEKIWPGYTEL 791
            ||||:|..|..|.|.:|:|:.||:.||.|:.:|||.|.::|::|..|.:.||:|....||..|.|
  Fly   175 RAPEILFGSQKYGTGVDMWAAGCVVAEMLRGVPLFAGTTDIEQLAIIIRTLGSPRLNQWPELTSL 239

  Fly   792 PAVKNMLSQNSQFTEYPVSQLRKHFQEKTSEMGLSLLQGLLTYDPKQRLSA 842
            |....:...||....:.     ..|...|..:.::|:..|:.|:||.||.|
  Fly   240 PDYSKIRFPNSVGIHWD-----NLFPSCTHAVEINLVSNLVVYNPKNRLKA 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PitslreNP_649251.2 STKc_CDC2L1 552..851 CDD:173741 99/301 (33%)
PLN00009 555..854 CDD:177649 99/298 (33%)
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 99/296 (33%)
S_TKc 9..288 CDD:214567 99/295 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442403
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.