DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pitslre and Cdk2

DIOPT Version :9

Sequence 1:NP_649251.2 Gene:Pitslre / 40292 FlyBaseID:FBgn0016696 Length:952 Species:Drosophila melanogaster
Sequence 2:NP_001163666.1 Gene:Cdk2 / 42453 FlyBaseID:FBgn0004107 Length:314 Species:Drosophila melanogaster


Alignment Length:313 Identity:135/313 - (43%)
Similarity:194/313 - (61%) Gaps:20/313 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   555 VEEFQCLNRIEEGTYGVVYRAKDKRTNEIVALKRLKMEKEKEGFPITSLREINTLLKGQHPNIVT 619
            ::.||...:|.|||||:||:|:...|.:.||||::::|.|.||.|.|::|||:.|...:|||:|.
  Fly     5 LDNFQRAEKIGEGTYGIVYKARSNSTGQDVALKKIRLEGETEGVPSTAIREISLLKNLKHPNVVQ 69

  Fly   620 VREIVVGSNMDKIFIVMDYVEHDLKSLMETMKNRKQSFFPGEVKCLTQQLLRAVAHLHDNWILHR 684
            :.::|:..|  .::::.:|:..|||.||:   .:|..|.|..:|....|:|.||...|.|.||||
  Fly    70 LFDVVISGN--NLYMIFEYLNMDLKKLMD---KKKDVFTPQLIKSYMHQILDAVGFCHTNRILHR 129

  Fly   685 DLKTSNLLLSHKGILKVGDFGLAREYGSPIKKYTSLVVTLWYRAPELLLCSPVYSTPIDVWSVGC 749
            |||..|||:...|.:|:.||||||.:..|::.||..||||||||||:||.:..|||.:|:||:||
  Fly   130 DLKPQNLLVDTAGKIKLADFGLARAFNVPMRAYTHEVVTLWYRAPEILLGTKFYSTGVDIWSLGC 194

  Fly   750 IFAEFLQMLPLFPGKSEIDELNRIFKELGTPNEKIWPGYTELPAVKNMLSQNSQFTEYPVSQLRK 814
            ||:|.:....||||.||||:|.|||:.|.||:|..|||.|:||..|         |::|..:...
  Fly   195 IFSEMIMRRSLFPGDSEIDQLYRIFRTLSTPDETNWPGVTQLPDFK---------TKFPRWEGTN 250

  Fly   815 HFQEKTSEMGLSLLQGLLTYDPKQRLSADAALKHGFFK------ELPLPIDPS 861
            ..|..|......|:..:|.|||..|:||..||:|.:|:      .:.||:||:
  Fly   251 MPQPITEHEAHELIMSMLCYDPNLRISAKDALQHAYFRNVQHVDHVALPVDPN 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PitslreNP_649251.2 STKc_CDC2L1 552..851 CDD:173741 130/295 (44%)
PLN00009 555..854 CDD:177649 131/304 (43%)
Cdk2NP_001163666.1 PLN00009 5..293 CDD:177649 131/301 (44%)
STKc_CDK1_CdkB_like 8..287 CDD:270829 130/292 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442401
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.