DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pitslre and Cdk9

DIOPT Version :9

Sequence 1:NP_649251.2 Gene:Pitslre / 40292 FlyBaseID:FBgn0016696 Length:952 Species:Drosophila melanogaster
Sequence 2:NP_001007744.1 Gene:Cdk9 / 362110 RGDID:1359638 Length:372 Species:Rattus norvegicus


Alignment Length:359 Identity:132/359 - (36%)
Similarity:190/359 - (52%) Gaps:46/359 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   552 CRSVEEFQCLNRIEEGTYGVVYRAKDKRTNEIVALKRLKMEKEKEGFPITSLREINTLLKGQHPN 616
            |..|.:::.|.:|.:||:|.|::||.::|.:.||||::.||.||||||||:||||..|...:|.|
  Rat    13 CDEVTKYEKLAKIGQGTFGEVFKAKHRQTGQKVALKKVLMENEKEGFPITALREIKILQLLKHEN 77

  Fly   617 IVTVREI----------VVGSNMDKIFIVMDYVEHDLKSLMETMKNRKQSFFPGEVKCLTQQLLR 671
            :|.:.||          ..||    |::|.|:.||||..|   :.|....|...|:|.:.|.||.
  Rat    78 VVNLIEICRTKASPYNRCKGS----IYLVFDFCEHDLAGL---LSNVLVKFTLSEIKRVMQMLLN 135

  Fly   672 AVAHLHDNWILHRDLKTSNLLLSHKGILKVGDFGLAREY----GSPIKKYTSLVVTLWYRAPELL 732
            .:.::|.|.|||||:|.:|:|::..|:||:.||||||.:    .|...:||:.|||||||.||||
  Rat   136 GLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELL 200

  Fly   733 LCSPVYSTPIDVWSVGCIFAEFLQMLPLFPGKSEIDELNRIFKELGTPNEKIWPG------YTEL 791
            |....|..|||:|..|||.||.....|:..|.:|..:|..|.:..|:...::||.      :.:|
  Rat   201 LGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDKYELFEKL 265

  Fly   792 PAVKNMLSQNSQFTEYPVSQLRKHFQEKTSEMGLSLLQGLLTYDPKQRLSADAALKHGFFKELPL 856
            ..||   .|..:..:...:.:|..:       .|.|:..||..||.||:.:|.||.|.||...|:
  Rat   266 ELVK---GQKRKVKDRLKAYVRDPY-------ALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPM 320

  Fly   857 PID---------PSMFPTWPAKSELGARKAQASS 881
            |.|         .|||.........|::..|.|:
  Rat   321 PSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQST 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PitslreNP_649251.2 STKc_CDC2L1 552..851 CDD:173741 121/318 (38%)
PLN00009 555..854 CDD:177649 122/318 (38%)
Cdk9NP_001007744.1 STKc_CDK9 6..315 CDD:270848 121/318 (38%)
T-loop. /evidence=ECO:0000250 166..191 10/24 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 343..372 3/12 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925637at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.