DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pitslre and Cdk10

DIOPT Version :9

Sequence 1:NP_649251.2 Gene:Pitslre / 40292 FlyBaseID:FBgn0016696 Length:952 Species:Drosophila melanogaster
Sequence 2:NP_919428.1 Gene:Cdk10 / 234854 MGIID:2448549 Length:360 Species:Mus musculus


Alignment Length:337 Identity:170/337 - (50%)
Similarity:232/337 - (68%) Gaps:13/337 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   552 CRSVEEFQCLNRIEEGTYGVVYRAKDKRTNEIVALKRLKMEKEKEGFPITSLREINTLLKGQHPN 616
            ||||:||:.||||.|||||:||||:|.:|:||||||:::|:|||:|.||:|||||..||:.:|||
Mouse    33 CRSVKEFEKLNRIGEGTYGIVYRARDTQTDEIVALKKVRMDKEKDGIPISSLREITLLLRLRHPN 97

  Fly   617 IVTVREIVVGSNMDKIFIVMDYVEHDLKSLMETMKNRKQSFFPGEVKCLTQQLLRAVAHLHDNWI 681
            ||.::|:|||::::.||:||.|.|.||.||:|.|..   .|...:|||:..|:||.:.:||.|:|
Mouse    98 IVELKEVVVGNHLESIFLVMGYCEQDLASLLENMPT---PFSEAQVKCIMLQVLRGLQYLHRNFI 159

  Fly   682 LHRDLKTSNLLLSHKGILKVGDFGLAREYGSPIKKYTSLVVTLWYRAPELLLCSPVYSTPIDVWS 746
            :|||||.||||::.||.:|..||||||.||.|:|..|..|||||||||||||.:...:|.||:|:
Mouse   160 IHRDLKVSNLLMTDKGCVKTADFGLARAYGVPVKPMTPKVVTLWYRAPELLLGTTTQTTSIDMWA 224

  Fly   747 VGCIFAEFLQMLPLFPGKSEIDELNRIFKELGTPNEKIWPGYTELPAVKNMLSQNSQFTEYPVSQ 811
            ||||.||.|...||.||.|||.:::.|.:.||||:|.||||:::||     |:......:.|.:.
Mouse   225 VGCILAELLAHKPLLPGTSEIHQIDLIVQLLGTPSENIWPGFSKLP-----LAGQYSLRKQPYNN 284

  Fly   812 LRKHFQEKTSEMGLSLLQGLLTYDPKQRLSADAALKHGFFKELPLPIDPSMFPTWP----AKSEL 872
            | ||.....||.||.||..|..||||:|.::...|:..:|||.|||.:|.:.||:|    .::..
Mouse   285 L-KHKFPWLSEAGLRLLNFLFMYDPKKRATSGDCLESSYFKEKPLPCEPELMPTFPHHRNKRAAP 348

  Fly   873 GARKAQASSPKP 884
            .|.:.|:...:|
Mouse   349 AAAEGQSKRCRP 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PitslreNP_649251.2 STKc_CDC2L1 552..851 CDD:173741 157/298 (53%)
PLN00009 555..854 CDD:177649 156/298 (52%)
Cdk10NP_919428.1 STKc_CDK10 31..339 CDD:173742 166/314 (53%)
PTZ00024 43..336 CDD:240233 157/301 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 334..360 5/25 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0663
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D392617at33208
OrthoFinder 1 1.000 - - FOG0001516
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R970
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.