DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4042 and Dmac2

DIOPT Version :9

Sequence 1:NP_001262121.1 Gene:CG4042 / 40291 FlyBaseID:FBgn0037018 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001277416.1 Gene:Dmac2 / 66349 MGIID:1913599 Length:258 Species:Mus musculus


Alignment Length:255 Identity:75/255 - (29%)
Similarity:118/255 - (46%) Gaps:42/255 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 EVSATVKRIR--SELAA-DKQKLKWRTP---IGDRPEDWNSKLKLFSNAEQTSDFIVMMQKPIDL 94
            |.:...:||.  |||.. |..:.|.||.   :.|.          |.:.:...::  ::||.|..
Mouse    14 EWNGRARRIHGMSELVTPDSSREKKRTLLQFLSDH----------FQDIQTLREY--LLQKQISK 66

  Fly    95 SPRNIRQWWENREERIERHMQQFVPERHKILGAELAAAHFILYRGGAVKFINDTHWRRASKDGEF 159
                     .|||.|...::|    |::   |..:|.|.|||.:||||||.:...|.|.:....|
Mouse    67 ---------VNRENRSFTNIQ----EKY---GPYVAGAVFILKQGGAVKFQDKEEWIRPNNRSHF 115

  Fly   160 KLPNKFDPRYKVEALRCDNMELYYEGLENLRCLDSLKFLSFHNVKSFDDWCLDR---ISGGGFPN 221
            ....:......|||:......:.|:||.||..|..|:.||.....:.|||||.|   ::|    :
Mouse   116 LAEIQKFQNVPVEAVDASGCAINYQGLSNLLPLKELRSLSLQRCPNLDDWCLSRLYLLAG----S 176

  Fly   222 LEVLDLS-CTQITSNGLACLYRFPKLKLLILNDPKETLELELSTVMLEEAMPALKIVGAD 280
            |:.|.|: |.:|:..|||||:....|:.|.::|........|:.:::||.:|..:::|||
Mouse   177 LQELSLAGCPRISERGLACLHHLQNLRRLDISDLPAVSHPGLTQILVEEMLPHCEVLGAD 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4042NP_001262121.1 leucine-rich repeat 192..221 CDD:275381 11/31 (35%)
leucine-rich repeat 222..245 CDD:275381 10/23 (43%)
Dmac2NP_001277416.1 leucine-rich repeat 127..140 CDD:275381 3/12 (25%)
AMN1 149..>221 CDD:187754 24/75 (32%)
leucine-rich repeat 151..176 CDD:275381 10/28 (36%)
leucine-rich repeat 177..201 CDD:275381 10/23 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839430
Domainoid 1 1.000 87 1.000 Domainoid score I7969
eggNOG 1 0.900 - - E1_KOG3864
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 88 1.000 Inparanoid score I5120
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007152
OrthoInspector 1 1.000 - - oto95395
orthoMCL 1 0.900 - - OOG6_109418
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4273
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.680

Return to query results.
Submit another query.