DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4042 and dmac2l

DIOPT Version :9

Sequence 1:NP_001262121.1 Gene:CG4042 / 40291 FlyBaseID:FBgn0037018 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001017243.1 Gene:dmac2l / 549997 XenbaseID:XB-GENE-978777 Length:199 Species:Xenopus tropicalis


Alignment Length:200 Identity:47/200 - (23%)
Similarity:90/200 - (45%) Gaps:26/200 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 KPIDLSPRNIRQ------W-WENRE-ERIERHMQQFVPERHKILGAELAAAHFILYRGGAVKFIN 146
            :|..:|.:.||.      | |.|.. .:::.       ||.|..|.:.||:.::|..|..|::..
 Frog     8 RPTFISKKQIRPGACRYFWGWLNAVFNKVDY-------ERIKDFGPDRAASEWLLRCGAHVRYKG 65

  Fly   147 DTHWRRASKDGEFKLPNKFDPRYKVEALRCDNMELYYEGLENLRCLDSLKFLSFHNVKSFDDWCL 211
            ...|:: ..:|   ||.....::|::|:...:..:.|.|.::|..|:.::.:........:|.||
 Frog    66 FERWQQ-DYNG---LPTGPLGKFKIQAINATDSCIMYRGFDHLDGLEHVEEIKLCKCIYIEDTCL 126

  Fly   212 DRIS-----GGGFPNLEVLDLSCTQITSNGLACLYRFPKLKLLILNDPKETLELELSTVMLEEAM 271
            :|:|     ......||:  :||..:|..|:..|.....|:.|.|:|.....:.:.:..||:.|.
 Frog   127 ERMSKIENLQNSLRRLEI--ISCGNVTDRGIIALNTLRNLEYLFLSDLPGITKKQTTVEMLQTAN 189

  Fly   272 PALKI 276
            |:|.:
 Frog   190 PSLHV 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4042NP_001262121.1 leucine-rich repeat 192..221 CDD:275381 6/33 (18%)
leucine-rich repeat 222..245 CDD:275381 7/22 (32%)
dmac2lNP_001017243.1 leucine-rich repeat 110..137 CDD:275381 5/26 (19%)
LRR_CC 138..158 CDD:197685 6/21 (29%)
leucine-rich repeat 139..163 CDD:275381 7/25 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4273
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.