DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4042 and dmac2l

DIOPT Version :9

Sequence 1:NP_001262121.1 Gene:CG4042 / 40291 FlyBaseID:FBgn0037018 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_956512.1 Gene:dmac2l / 393187 ZFINID:ZDB-GENE-040426-959 Length:199 Species:Danio rerio


Alignment Length:237 Identity:56/237 - (23%)
Similarity:93/237 - (39%) Gaps:56/237 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RSELAADKQKLKWRTPIGDRPEDWNSKLKLFSNAEQTSDFIVMMQKPIDLSPRNIRQWWENREER 109
            |..|:|.||      |.|.|.|.|.....:|:..:.                             
Zfish     9 RRILSAHKQ------PSGGRREFWGWLNAVFNKVDY----------------------------- 38

  Fly   110 IERHMQQFVPERHKILGAELAAAHFILYRGGAVKFINDTHWRRASKDGEFKLPNKFDPRYKVEAL 174
                      ||.|.:|.:.|||.::|..|..|:|.....|:. ..:|   ||.....||::||:
Zfish    39 ----------ERIKAVGPDRAAAEWLLRCGAKVRFRGFDRWQH-DYNG---LPTGPLGRYRIEAI 89

  Fly   175 RCDNMELYYEGLENLRCLDSLKFLSFHNVKSFDDWCLDRISGGGFPNL-----EVLDLSCTQITS 234
            ......:.|.|.::|..|:.::.:..:.....:|.||:|:  |....|     ::..:||..:|.
Zfish    90 DATESCIMYRGFDHLEGLEHVEEIRLNKCIYIEDACLERL--GQIKTLQDTVKQMTVVSCGNVTD 152

  Fly   235 NGLACLYRFPKLKLLILNDPKETLELELSTVMLEEAMPALKI 276
            .||..|:...||:.|.|:|.....:.:.:...|:.|:|.|.|
Zfish   153 KGLIALHHLGKLERLFLSDLPGVKDKDQTVDRLQAALPRLTI 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4042NP_001262121.1 leucine-rich repeat 192..221 CDD:275381 6/28 (21%)
leucine-rich repeat 222..245 CDD:275381 7/27 (26%)
dmac2lNP_956512.1 leucine-rich repeat 111..129 CDD:275381 3/17 (18%)
leucine-rich repeat 132..163 CDD:275381 7/30 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3864
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.