DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4042 and Dmac2

DIOPT Version :9

Sequence 1:NP_001262121.1 Gene:CG4042 / 40291 FlyBaseID:FBgn0037018 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_017444840.1 Gene:Dmac2 / 361520 RGDID:1549698 Length:278 Species:Rattus norvegicus


Alignment Length:223 Identity:58/223 - (26%)
Similarity:99/223 - (44%) Gaps:32/223 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 FSNAEQTSDFIVMMQ-KPIDLSPRNIRQWWENREERIERHMQQFVPERH---KILGAELAAAHFI 135
            |.:.:...::::..| ..:.:..|:.|:..|.....|....|   |.:|   :.:....:|...:
  Rat    49 FHDVQTLREYLLQKQISKVSMENRSYRKIQERYGPYITGQPQ---PPKHWAFRHVVVPTSAPTLM 110

  Fly   136 LYRGG----AVKFINDTHWRRASKDGEF-----KLPNKFDPRYKVEALRCDNMELYYEGLENLRC 191
            |...|    .||......|.|.:..|..     |:|        |||:......:.|:||.||..
  Rat   111 LSNIGLVVSCVKGFQGRDWIRPNDRGHSIAELQKVP--------VEAVDASGCAINYQGLSNLLP 167

  Fly   192 LDSLKFLSFHNVKSFDDWCLDR---ISGGGFPNLEVLDLS-CTQITSNGLACLYRFPKLKLLILN 252
            |..|:|||.....:.|||||.|   ::|    :|:.|.|: |.:|:..|||||:....|:.|.::
  Rat   168 LKELQFLSLQRCPNLDDWCLSRLYLLAG----SLQELSLAGCPRISERGLACLHHLQNLRRLDIS 228

  Fly   253 DPKETLELELSTVMLEEAMPALKIVGAD 280
            |........|:.:::||.:|..:::|.|
  Rat   229 DLPAVSHPGLTQILVEEMLPHCEVLGVD 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4042NP_001262121.1 leucine-rich repeat 192..221 CDD:275381 12/31 (39%)
leucine-rich repeat 222..245 CDD:275381 10/23 (43%)
Dmac2XP_017444840.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343246
Domainoid 1 1.000 80 1.000 Domainoid score I8372
eggNOG 1 0.900 - - E1_KOG3864
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I5119
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1458966at2759
OrthoFinder 1 1.000 - - FOG0007152
OrthoInspector 1 1.000 - - oto98881
orthoMCL 1 0.900 - - OOG6_109418
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.660

Return to query results.
Submit another query.