DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4042 and Y53G8AR.8

DIOPT Version :9

Sequence 1:NP_001262121.1 Gene:CG4042 / 40291 FlyBaseID:FBgn0037018 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_497686.2 Gene:Y53G8AR.8 / 175431 WormBaseID:WBGene00021815 Length:455 Species:Caenorhabditis elegans


Alignment Length:262 Identity:89/262 - (33%)
Similarity:139/262 - (53%) Gaps:21/262 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 EEEVSATVKRIRSELAADKQKLK--WRTPIG-----DRPEDWNSKLKLFSNAEQTSDFIVM---- 87
            :|..:|.|:.::     :||:.|  .|.|.|     :||:|.|.|........:.:..:.|    
 Worm    31 QEMQAAHVENVQ-----EKQRNKNFIRLPTGLYITPERPDDLNPKKAPADMTRKDTGQLPMELLT 90

  Fly    88 ---MQKPIDLSPRNIRQWWENREERIERHMQQFVPERHKILGAELAAAHFILYRGGAVKFINDTH 149
               ..:.:|.|..||:::...::.:..::.|:.:|||...||.:||||||:::||.||||:.|.:
 Worm    91 WHTQMRYVDHSIDNIKRYRRYKKFQHMQYDQRVIPERLLFLGPDLAAAHFLVHRGAAVKFVGDDN 155

  Fly   150 WRRASKDGEFKLPNKFDPRYKVEALRCDNMELYYEGLENLRCLDSLKFLSFHNVKSFDDWCLDRI 214
            |.:..|...:.||.:......:||:.....::.:||||||..|..|:.|...|.:..||||:.||
 Worm   156 WYKKDKWNRYSLPGRKVDNLFIEAIDASGTQIMFEGLENLENLQKLRLLRLANSEYVDDWCIGRI 220

  Fly   215 SGGGFPNLEVLDLS-CTQITSNGLACLYRFPKLKLLILNDPKETLELELSTVMLEEAMPALKIVG 278
             ||..||||:|||| |.:|:|.||..|.....||.|.|........|..|.::||:.:|.|:|:|
 Worm   221 -GGLLPNLEMLDLSGCHRISSKGLMGLKASKNLKFLRLEGLSGIRNLGKSALILEDLLPKLQILG 284

  Fly   279 AD 280
            .|
 Worm   285 MD 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4042NP_001262121.1 leucine-rich repeat 192..221 CDD:275381 12/28 (43%)
leucine-rich repeat 222..245 CDD:275381 12/23 (52%)
Y53G8AR.8NP_497686.2 leucine-rich repeat 177..200 CDD:275381 9/22 (41%)
AMN1 <194..283 CDD:187754 38/89 (43%)
leucine-rich repeat 201..226 CDD:275381 11/25 (44%)
leucine-rich repeat 227..251 CDD:275381 12/23 (52%)
leucine-rich repeat 252..279 CDD:275381 8/26 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160738
Domainoid 1 1.000 131 1.000 Domainoid score I3199
eggNOG 1 0.900 - - E1_KOG3864
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I3185
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007152
OrthoInspector 1 1.000 - - oto17298
orthoMCL 1 0.900 - - OOG6_109418
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4273
SonicParanoid 1 1.000 - - X11813
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.680

Return to query results.
Submit another query.