DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4074 and Vps26

DIOPT Version :10

Sequence 1:NP_649249.2 Gene:CG4074 / 40290 FlyBaseID:FBgn0037017 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_569952.2 Gene:Vps26 / 31144 FlyBaseID:FBgn0014411 Length:478 Species:Drosophila melanogaster


Alignment Length:294 Identity:61/294 - (20%)
Similarity:118/294 - (40%) Gaps:53/294 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 QETKHEGIILY-----LEGIVNLQL------------SAKTVGLFDAFYNSVKPINLLQNSLELS 80
            ::.|.|.::|:     :.|.||:.|            ..:.:|..:.:|:..........:..|:
  Fly    29 EDGKVEKMLLFYDGETVSGKVNVTLKKPGSKLEHQGIKIEFIGQIELYYDRGNHHEFKCLAKALA 93

  Fly    81 APGKLSAGRSEFHFELPLVCKKEPRILYETYHGVFINVNYQLTCTVKRNFLGKATTKIQQFCVQY 145
            .||.|....| :.|:.|.|.|:     :|.|.|..:.:.|.|..|:.|.                
  Fly    94 RPGDLIQNNS-YPFDFPKVEKQ-----FEVYAGSNVRLRYFLRATIVRR---------------- 136

  Fly   146 KPVPLSEDSKKVVPFSLSPDSL----QKNASAKERLSMPRFL-ITGRLDRSEFCVTTPITGSITV 205
                :|:.:|:|   .::..:|    :.|...|..:.:...| |....::|::.:...|.|.|..
  Fly   137 ----ISDITKEV---DIAVHTLCSYPEMNNPIKMEVGIEDCLHIEFEYNKSKYHLRDTIIGKIYF 194

  Fly   206 QHTEAAIKSIEMQLVRVETCGCDEGYSKDATEIQTIQIADGNVLPKLELPIHMVLPRLFTCPTL- 269
            ......||.:|:.:::.|:.|.......:...|...:|.||..:....:||.:.|......||: 
  Fly   195 LLVRIKIKHMEIAIIKKESTGTGPTMFNENETIAKYEIMDGAPVKGESIPIRVFLAGYNLTPTMR 259

  Fly   270 -LTKNFKIEFELNLIVVFKEDYTVSENFKIVLKR 302
             :.|.|.:::.|||:::..||....:..:|.|.|
  Fly   260 DINKKFSVKYFLNLVLMDTEDRRYFKQQEITLWR 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4074NP_649249.2 Arrestin_N 6..289 CDD:451447 56/279 (20%)
Vps26NP_569952.2 Vps26 6..280 CDD:397622 56/279 (20%)
Herpes_BLLF1 <317..>408 CDD:282904
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.