DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13252 and CSS1

DIOPT Version :9

Sequence 1:NP_649248.3 Gene:CG13252 / 40289 FlyBaseID:FBgn0037016 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_012097.1 Gene:CSS1 / 854637 SGDID:S000001431 Length:995 Species:Saccharomyces cerevisiae


Alignment Length:308 Identity:61/308 - (19%)
Similarity:84/308 - (27%) Gaps:112/308 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 CLNRKCVCKTCYIPDCPSDADEDVVVVELVPENNQTPG---EC----CG----TYECQAEPNCTV 156
            |.:......:|....|........||.|.|...:.|..   .|    |.    |.||..|.:.|.
Yeast   692 CSSTTATITSCDETGCHVSTSTGAVVTETVSSKSYTTATVTHCDDNGCNTKTVTSECSKETSATT 756

  Fly   157 VRDTDFHWLKQCRRCKCESGLKICHKTCDERAEGVCQSKISGMFYKDGENWTENCKTCECEKGE- 220
            ...            |..:.:.:.|  ||:..   |                 |.||...|..| 
Yeast   757 ASP------------KSYTTVTVTH--CDDNG---C-----------------NTKTVTSEAPEA 787

  Fly   221 -----------PKCTMSFCGNLNC-----PSEQQVMLKDTCCPVCW-----PKCAPMPHEKQDDG 264
                       ...|::.|.:..|     .||.......|..|..:     .:|        ||.
Yeast   788 TTTTTVSSQSYTTATVTHCDDNGCKTKTVTSEAPEATTTTVSPKTYTTATVTQC--------DDN 844

  Fly   265 SYEDYVDESETPEEDSLPPLLPDPLTTQQSAELVATSTTTSSNG------------TTSTTVVP- 316
            ........||.|||.|.....|...||       .|.|....||            .|:|||.| 
Yeast   845 GCSTKTVTSECPEETSATTTSPKSYTT-------VTVTHCDDNGCNTKTVTSEAPEATTTTVSPK 902

  Fly   317 ---LAATVNCNN--------AFDQPKVVEVVNQTN------YYFYWLV 347
               .|....|::        ..:.||.....::|:      :|.:||:
Yeast   903 TYTTATVTQCDDNGCSTKTVTSEAPKETSETSETSAAPKDIHYCHWLL 950

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13252NP_649248.3 VWC 197..249 CDD:302663 12/68 (18%)
CSS1NP_012097.1 Hyphal_reg_CWP 313..596 CDD:371712
PRK12355 627..>977 CDD:237072 61/308 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.