DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13252 and HPF1

DIOPT Version :9

Sequence 1:NP_649248.3 Gene:CG13252 / 40289 FlyBaseID:FBgn0037016 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_014487.1 Gene:HPF1 / 854010 SGDID:S000005515 Length:967 Species:Saccharomyces cerevisiae


Alignment Length:306 Identity:58/306 - (18%)
Similarity:88/306 - (28%) Gaps:99/306 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 CLNRKCVCKTCYIPDCPSDADEDVVVVELVPENNQTP---GEC----CG----TYECQAEPNCTV 156
            |.:......:|....|........|..|.|...:.|.   ..|    |.    |.||..|.:.|.
Yeast   715 CSSTTATITSCDETGCHVTTSTGTVATETVSSKSYTTVTVTHCDNNGCNTKTVTSECPEETSATT 779

  Fly   157 VRDTDFHWLKQCRRCKCESGLKICHKTCDERAEGVCQSKISGMFYKDGENWTENCKTCECEKGE- 220
            ...            |..:.:.:.|  ||:..   |                 |.||...|..| 
Yeast   780 TSP------------KSYTTVTVTH--CDDNG---C-----------------NTKTVTSEAPEA 810

  Fly   221 ------PK----CTMSFCGNLNC---------PSEQQVMLKDTCCPVCW-----PKCAPMPHEKQ 261
                  ||    .|::.|.:..|         |.|.....:.:..|..:     .:|        
Yeast   811 TTTTVSPKTYTTATVTQCDDNGCSTKTVTSEAPKETSETSETSAAPKTYTTATVTQC-------- 867

  Fly   262 DDGSYEDYVDESETPEEDS---LPPLLPDPLTTQQSAELVATSTTT------SSNGTTSTTVVPL 317
            ||......:..|:.||..|   .....|...||..|....|||.||      |:..|.|.:..|:
Yeast   868 DDNGCNVKIITSQIPEATSTVTATSASPKSYTTVTSEGSKATSLTTAISKASSAISTYSKSAAPI 932

  Fly   318 AATVNCNNAFDQPKVVEVVNQTNYYFYWLVPYSVIASIAIVVMSFY 363
            ..:..            ::.|:......|...::.|.:.|.|::|:
Yeast   933 KTSTG------------IIVQSEGIAAGLNANTLNALVGIFVLAFF 966

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13252NP_649248.3 VWC 197..249 CDD:302663 13/71 (18%)
HPF1NP_014487.1 Hyphal_reg_CWP 337..617 CDD:403079
Herpes_BLLF1 <643..937 CDD:282904 52/263 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.