DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13252 and ZAN

DIOPT Version :9

Sequence 1:NP_649248.3 Gene:CG13252 / 40289 FlyBaseID:FBgn0037016 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_003377.2 Gene:ZAN / 7455 HGNCID:12857 Length:2812 Species:Homo sapiens


Alignment Length:411 Identity:86/411 - (20%)
Similarity:129/411 - (31%) Gaps:131/411 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 TLDQEPLPD---------LCQSVKCPPDAEMQC----PADSSIRHNLLAVDLIKSNAV------- 72
            :||....||         |..:.|.|..:|..|    ...||.:.|.:|....|:.|:       
Human  1687 SLDDNLRPDRKLAGDSMQLGAAWKLPESSEPGCFLVGGKPSSCQENSMADAWNKNCAILINPQGP 1751

  Fly    73 ------ELPNASEMASAADGVSYNRG-----LISDEDYVQCCL---------NR-----KCVCKT 112
                  .:|..|..||...|....:|     ..|.:.|...|.         ||     :|...:
Human  1752 FSQCHQVVPPQSSFASCVHGQCGTKGDTTALCRSLQAYASLCAQAGQAPAWRNRTFCPMRCPPGS 1816

  Fly   113 CYIPDCPSDADEDVVVVELVPENNQTPGECCGTYECQAEPNCTVVRDTDFHWLKQCRRCKCESGL 177
            .|.| |.|...:....:     ||  |.:|.....|                   ...|:|:.|.
Human  1817 SYSP-CSSPCPDTCSSI-----NN--PRDCPKALPC-------------------AESCECQKGH 1854

  Fly   178 KICHKTCDERAEGVCQSKISGMFYKDGENW-TENCKT--CECE-KGEPKCTMSFC---------- 228
            .:...:|....:..|... :|.::..||.| |||..|  |.|. .....|..|.|          
Human  1855 ILSGTSCVPLGQCGCTDP-AGSYHPVGERWYTENTCTRLCTCSVHNNITCFQSTCKPNQICWALD 1918

  Fly   229 GNLNC----------PSEQQVM--------LKDTC----CPVCWPKCAPMP-------HEKQDDG 264
            |.|:|          |.|...:        :.|.|    ..||.|..| :|       |||::.|
Human  1919 GLLHCRASGVGVCQLPGESHYVSFDGSNHSIPDACTLVLVKVCHPAMA-LPFFKISAKHEKEEGG 1982

  Fly   265 S--------YEDYVDESETPEEDSLPPLLPDPLTTQQSAELVATSTTTSSNGTTSTTVVPLAATV 321
            :        |.|..|...|.::.....:....:|....:::...|..:||  ..|...:.:...|
Human  1983 TEAFRLHEVYIDIYDAQVTLQKGHRVLINSKQVTLPAISQIPGVSVKSSS--IYSIVNIKIGVQV 2045

  Fly   322 NCNNAFDQPKVVEVVNQTNYY 342
            .    ||...::|:...|.||
Human  2046 K----FDGNHLLEIEIPTTYY 2062

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13252NP_649248.3 VWC 197..249 CDD:302663 20/87 (23%)
ZANNP_003377.2 MAM 41..203 CDD:306977
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 61..84
MAM 211..367 CDD:306977
MAM 373..535 CDD:306977
Atrophin-1 <540..1022 CDD:331285
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 545..884
66 X heptapeptide repeats (approximate) (mucin-like domain) 573..1041
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 904..929
TIL 1044..1093 CDD:307783
TILa 1095..1148 CDD:315397
VWD 1156..1308 CDD:306577
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1302..1323
C8 1349..1423 CDD:214843
TIL 1426..1479 CDD:307783
TILa 1481..1535 CDD:315397
VWD 1542..1695 CDD:306577 2/7 (29%)
C8 1742..1808 CDD:312319 12/65 (18%)
TILa 1869..1924 CDD:315397 16/55 (29%)
VWD 1931..2084 CDD:306577 29/139 (21%)
C8 2149..2207 CDD:312319
TIL 2211..2267 CDD:307783
TILa 2269..2320 CDD:315397
VWD 2331..2484 CDD:306577
C8 2543..>2597 CDD:214843
TILa 2654..2707 CDD:315397
EGF 2712..2740 CDD:306513
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.