DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13252 and Otogl

DIOPT Version :9

Sequence 1:NP_649248.3 Gene:CG13252 / 40289 FlyBaseID:FBgn0037016 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001171038.1 Gene:Otogl / 628870 MGIID:3647600 Length:2325 Species:Mus musculus


Alignment Length:280 Identity:63/280 - (22%)
Similarity:91/280 - (32%) Gaps:126/280 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LCQSVKCPPDAEMQCPADSSIRHNLLAVDLIKSNAVELPNASEMASAADGVSYNRGLISDEDYVQ 101
            :|:...|||.: ::|..|         ::|:|.|                       :|.    |
Mouse  2013 VCEPDLCPPPS-LECAKD---------MNLVKEN-----------------------VSG----Q 2040

  Fly   102 CCLNRKCV--CKTCYIPDCPSDADEDVVVVELVPENNQTPGEC-CGTYECQ-------------- 149
            ||.|.:|.  |:|..:|.|      ||.....:.:|.||  :| |..|.|:              
Mouse  2041 CCPNWRCECNCETLVMPTC------DVGEFAAIDQNFQT--DCGCVQYLCEKDDVCVFQEVSVLN 2097

  Fly   150 ---------AEPNCTVV-----RD--TDFHWLKQCRRCKCESGLKICHKTCDER----------- 187
                     .|..|.::     :|  ||||.|...        :..|.|.||..           
Mouse  2098 PGQSLIKYLEEEFCYIIECLDEKDNYTDFHTLNVT--------MVNCSKDCDAHQIYIPSSSDYD 2154

  Fly   188 AEGVCQSKISGMF---------YKDGENWTENCKTCECEKGEPKCTMSFCGNLN----CPSEQQV 239
            ..|.|:: ||..|         |::|..|..||.|.||...|...|:     ||    ||...:.
Mouse  2155 CCGTCKN-ISCKFIMENGTSVIYEEGSTWHYNCSTYECVNTEEGATI-----LNYSMVCPPFNET 2213

  Fly   240 MLK----------DTCCPVC 249
            ..|          :.||.:|
Mouse  2214 ECKLNEGIVKLYNEGCCKIC 2233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13252NP_649248.3 VWC 197..249 CDD:302663 19/74 (26%)
OtoglNP_001171038.1 VWD 114..260 CDD:365869
C8 312..373 CDD:370094
TIL 386..434 CDD:366828
VWD 463..625 CDD:214566
C8 669..732 CDD:370094
TIL 736..791 CDD:366828
VWD 930..1085 CDD:214566
C8 1120..1194 CDD:214843
Fascin <1263..1350 CDD:390083
VWD 1498..1671 CDD:214566
C8 1705..1775 CDD:214843
TIL 1778..1836 CDD:366828
GHB_like 2252..2325 CDD:389804
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.