DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13252 and NELL1

DIOPT Version :10

Sequence 1:NP_649248.3 Gene:CG13252 / 40289 FlyBaseID:FBgn0037016 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001275642.1 Gene:NELL1 / 4745 HGNCID:7750 Length:838 Species:Homo sapiens


Alignment Length:226 Identity:55/226 - (24%)
Similarity:78/226 - (34%) Gaps:83/226 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 CCLNRKCVCKTCYI-PDCPSDADE-DVVVVELVPENNQT-----PG----EC------CGTYE-- 147
            |....||||.:.:. ..|..|.|| ...::|.   :|.:     ||    ||      .|||.  
Human   557 CVAPNKCVCPSGFTGSHCEKDIDECSEGIIEC---HNHSRCVNLPGWYHCECRSGFHDDGTYSLS 618

  Fly   148 ---------------------------------CQAEPNCT-------VVRDTDFHW-LKQ--CR 169
                                             |.:.|:|:       .::.....| ||:  |.
Human   619 GESCIDIDECALRTHTCWNDSACINLAGGFDCLCPSGPSCSGDCPHEGGLKHNGQVWTLKEDRCS 683

  Fly   170 RCKCESGLKICHKT----------------CDERAEGVCQSKISGMFYKDGENWTENCKTCECEK 218
            .|.|:.|...|.:|                ||.|....|..:.....|:.|:|||.:|:.|.|.:
Human   684 VCSCKDGKIFCRRTACDCQNPSADLFCCPECDTRVTSQCLDQNGHKLYRSGDNWTHSCQQCRCLE 748

  Fly   219 GEPKCTMSFCGNLNCPSEQQVMLKDTCCPVC 249
            ||..|....|.||:|  |...:|:..|||.|
Human   749 GEVDCWPLTCPNLSC--EYTAILEGECCPRC 777

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13252NP_649248.3 VWC 197..249 CDD:450195 20/51 (39%)
NELL1NP_001275642.1 TSPN 57..241 CDD:214560
VWC 301..359 CDD:278520
EGF_CA 462..>494 CDD:214542
EGF_3 508..543 CDD:463759
EGF_CA 577..614 CDD:214542 9/39 (23%)
EGF_CA 624..655 CDD:429571 1/30 (3%)
VWC 662..714 CDD:450195 9/51 (18%)
VWC 729..777 CDD:450195 20/49 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.