DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG13252 and NEFM

DIOPT Version :9

Sequence 1:	NP_649248.3	Gene:	CG13252 / 40289	FlyBaseID:	FBgn0037016	Length:	384	Species:	Drosophila melanogaster
Sequence 2:	NP_005373.2	Gene:	NEFM / 4741	HGNCID:	7734	Length:	916	Species:	Homo sapiens

Alignment Length:	115	Identity:	26/115 - (22%)
Similarity:	44/115 - (38%)	Gaps:	32/115 - (27%)

- Green bases have known domain annotations that are detailed below.

  Fly   177 LKICHKTCDERAEGVCQSKISGMFYKDGENWT------------ENCKTCECEKGEPKCTMSFCG 229
            ||:.||..:|..|   ::|:.....:..|..|            |..:..|.::.||:.
Human   446 LKVQHKFVEEIIE---ETKVEDEKSEMEEALTAITEELAVSMKEEKKEAAEEKEEEPEA------ 501

  Fly   230 NLNCPSEQQVMLKDTCCPVCWPKCAPMPHEKQDDGSYEDYVDESETPEED 279
                 .|::|..|.:      |..|..|..|:::|..|:...:.|..|||
Human   502 -----EEEEVAAKKS------PVKATAPEVKEEEGEKEEEEGQEEEEEED 540

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG13252	NP_649248.3	VWC	197..249	CDD:302663	9/63 (14%)
NEFM	NP_005373.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..51
		Head	2..104
		Filament_head	10..78	CDD:282575
		Filament	100..411	CDD:278467
		Coil 1A	105..136
		Linker 1	137..149
		Coil 1B	150..248
		Linker 12	249..265
		Coil 2A	266..287
		Linker 2	288..291
		Coil 2B	292..412
		Tail	413..916		26/115 (23%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	485..851		17/73 (23%)
		6 X 13 AA approximate tandem repeats of K-S-P-V-[PS]-K-S-P-V-E-E-[KA]-[GAK]	614..691
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1216
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900