DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13252 and MUC5AC

DIOPT Version :9

Sequence 1:NP_649248.3 Gene:CG13252 / 40289 FlyBaseID:FBgn0037016 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001291288.1 Gene:MUC5AC / 4586 HGNCID:7515 Length:5654 Species:Homo sapiens


Alignment Length:211 Identity:51/211 - (24%)
Similarity:68/211 - (32%) Gaps:68/211 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 QCCLNRKCVCKTCYIP---DCPSDADEDVVVVELVPENNQTPGECCGTYECQ----------AEP 152
            |||....|.|.|...|   .||..|       ..:|...:  |.||....|.          .:|
Human  5337 QCCPQYSCACNTSRCPAPVGCPEGA-------RAIPTYQE--GACCPVQNCSWTVCSINGTLYQP 5392

  Fly   153 NCTVVRDTDFHWLKQCRRCKCE-------------SGLKICHKTCDERAE---------GVC--- 192
            ...|....       |..|:||             ...:||:..|....|         |.|   
Human  5393 GAVVSSSL-------CETCRCELPGGPPSDAFVVSCETQICNTHCPVGFEYQEQSGQCCGTCVQV 5450

  Fly   193 -----QSKISGMFYKDGENWTE---NCKTCECEKGEP----KCTMSFCGNLNCPSEQQVMLKDTC 245
                 .||.....:..||.|::   :|.|.:|||.:.    ..|...|..|:|..::..|.||.|
Human  5451 ACVTNTSKSPAHLFYPGETWSDAGNHCVTHQCEKHQDGLVVVTTKKACPPLSCSLDEARMSKDGC 5515

  Fly   246 CPVCWPKCAPMPHEKQ 261
            |..|.|  .|.|::.|
Human  5516 CRFCPP--PPPPYQNQ 5529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13252NP_649248.3 VWC 197..249 CDD:302663 17/58 (29%)
MUC5ACNP_001291288.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..49
VWD 74..216 CDD:214566
C8 266..334 CDD:370094
TIL 338..394 CDD:366828
VWD 423..587 CDD:214566
C8 624..694 CDD:214843
TIL 704..761 CDD:366828
TIL 802..863 CDD:366828
VWD 892..1051 CDD:214566
C8 1088..1162 CDD:214843
PHA03247 <1335..1576 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1336..1377
9 X Cys-rich subdomain repeats 1383..4731
Mucin2_WxxW 1389..1475 CDD:372569
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1483..1575
Mucin2_WxxW 1584..1670 CDD:372569
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1688..1733
Mucin2_WxxW 1749..1840 CDD:372569
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1849..1948
Mucin2_WxxW 1957..2043 CDD:372569
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2059..2110
Mucin2_WxxW 2122..2213 CDD:372569
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2224..3214
107 X 8 AA approximate tandem repeats of T-T-S-T-T-S-A-P 2257..3200
Mucin2_WxxW 3228..3319 CDD:372569
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 3329..3515
17 X 8 AA approximate tandem repeats of T-T-S-T-T-S-A-P 3363..3498
Mucin2_WxxW 3526..3617 CDD:372569
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 3628..3951
34 X 8 AA approximate tandem repeats of T-T-S-T-T-S-A-P 3661..3931
Mucin2_WxxW 3959..4050 CDD:372569
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 4060..4625
58 X 8 AA approximate tandem repeats of T-T-S-T-T-S-A-P 4093..4595
Mucin2_WxxW 4633..4724 CDD:372569
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 4830..4849
VWD 4911..5079 CDD:214566
C8 5147..5205 CDD:370094
VWC 5383..5447 CDD:327433 11/70 (16%)
CT 5534..5616 CDD:214482
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 5622..5654
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.