DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13252 and cv-2

DIOPT Version :9

Sequence 1:NP_649248.3 Gene:CG13252 / 40289 FlyBaseID:FBgn0037016 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_524809.2 Gene:cv-2 / 45280 FlyBaseID:FBgn0000395 Length:751 Species:Drosophila melanogaster


Alignment Length:288 Identity:56/288 - (19%)
Similarity:96/288 - (33%) Gaps:87/288 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 DLCQSVKCPPDAEMQCPADSSIRHNLLAVDLIKSNAVELPNASEMASAADGVSYNRGLISDEDYV 100
            |.|::.||     :......:|:......|   :|.::.|...|......|...|...:::...|
  Fly   141 DPCKTYKC-----VATVVTETIQKCYSQCD---NNQLQPPRPGECCPTCQGCKINGQTVAEGHEV 197

  Fly   101 QCCLNRKC-VC-----------KTCYIPDCPSDADEDVVVVELVPENNQTPGECCGTYECQAEPN 153
            ...::.:| ||           |||.:..||            :.:..:.|.|||        |.
  Fly   198 DASIDDRCLVCQCRGTQLTCSKKTCPVLPCP------------MSKQIKRPDECC--------PR 242

  Fly   154 C-----------------TVVRDTDFHWLKQCRRCKCESGLKICHK-TCD--------ERAEGVC 192
            |                 :|..:.......:|..|.|.:|..:|.: ||.        :..:|.|
  Fly   243 CPQNHSFLPVPGKCLFNKSVYPEKTQFMPDRCTNCTCLNGTSVCQRPTCPILECAPEFQEPDGCC 307

  Fly   193 ----------QSKISGMFYKDGENWTEN-CKTCECEKGEPKCTMSFCGNLNCPSEQQVMLKD--- 243
                      :..:.|:.|::.|.|... |::|.|..|..:|....|..:.|.:.::  ||.   
  Fly   308 PRCAVAEVRSECSLDGIVYQNNETWDMGPCRSCRCNGGTIRCAQMRCPAVKCRANEE--LKQPPG 370

  Fly   244 TCCPVCWPKCAPM-----PHEKQDDGSY 266
            .||..|.......     ||.:..||.:
  Fly   371 ECCQRCVETAGTCTVFGDPHFRTFDGKF 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13252NP_649248.3 VWC 197..249 CDD:302663 15/55 (27%)
cv-2NP_524809.2 VWC 184..243 CDD:214564 15/78 (19%)
VWC 256..310 CDD:278520 10/53 (19%)
VWC 319..376 CDD:214564 15/58 (26%)
VWD 371..536 CDD:214566 7/28 (25%)
C8 580..646 CDD:285899
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.