DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13252 and crim1

DIOPT Version :9

Sequence 1:NP_649248.3 Gene:CG13252 / 40289 FlyBaseID:FBgn0037016 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_997986.1 Gene:crim1 / 404210 ZFINID:ZDB-GENE-040312-2 Length:1027 Species:Danio rerio


Alignment Length:245 Identity:64/245 - (26%)
Similarity:96/245 - (39%) Gaps:76/245 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 CQSVKCPPDAEMQCPADSSIRHNLLAVDLIKSNAVELPNASEMASAADGVSYNRGLISDEDYVQC 102
            |.:|:|||...:||||||                    ..:::...|||               |
Zfish   249 CSTVECPPVKPVQCPADS--------------------YETQVRLTADG---------------C 278

  Fly   103 C-LNRKCVC--KTCYIPDCPSDADEDVVVVELVPENNQTPGECCGTYEC--QAEPNCTV----VR 158
            | |..:|.|  ..|..|.|.:.....|     :...:.|||.||..:||  :.:|.||:    ..
Zfish   279 CTLPTRCECLPGLCTFPQCSAGMSPQV-----MSRGDGTPGRCCDVFECVNETKPACTLNGVEYH 338

  Fly   159 DTDFHWLKQCRRCKCESGLKICHKT------C------DERAEGVCQSKI-----------SGMF 200
            |.|...:..||.|:|:.|:.:|...      |      |.....||:..|           :|..
Zfish   339 DGDMFRMDACRFCRCQGGVSVCFTAQCGVLHCERYYVPDGECCPVCEDPIYPVLSLAGCYVNGQI 403

  Fly   201 YKDGENWTE-NCKTCECEKGEPKCTMSFCGNLNCPSEQQVMLKDTCCPVC 249
            ...|::|.| :|..|:|..|:.:|..:.||: :|.:  .|.:...|||||
Zfish   404 LAHGDHWREDDCTFCQCVSGDARCVAAACGH-SCLN--PVTVPGECCPVC 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13252NP_649248.3 VWC 197..249 CDD:302663 16/52 (31%)
crim1NP_997986.1 IGFBP 33..84 CDD:278641
Cell attachment site. /evidence=ECO:0000255 308..310 0/1 (0%)
VWC 330..384 CDD:214564 12/53 (23%)
VWC 397..450 CDD:302663 16/55 (29%)
Antistasin 561..586 CDD:280912
VWC 607..657 CDD:302663
VWC 678..729 CDD:302663
VWC 751..803 CDD:302663
VWC 812..866 CDD:302663
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 877..897
Cell attachment site. /evidence=ECO:0000255 883..885
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3256
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.