DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13252 and Rcd2

DIOPT Version :9

Sequence 1:NP_649248.3 Gene:CG13252 / 40289 FlyBaseID:FBgn0037016 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_649244.3 Gene:Rcd2 / 40283 FlyBaseID:FBgn0037012 Length:452 Species:Drosophila melanogaster


Alignment Length:447 Identity:100/447 - (22%)
Similarity:149/447 - (33%) Gaps:178/447 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 EDYVQCCLNRKCVCKTCYIPDC-PSDADEDV--------------VVVELVPENNQTPGECCGTY 146
            |..:..||..: :.::|.:|.. |...||.:              |:|| |...|..||.||..|
  Fly     2 EKLITICLLLR-ILQSCAMPIIDPDSIDESLACPPCENDFPICYKVIVE-VERGNGLPGSCCPRY 64

  Fly   147 EC-QAEPNCTVVRDTDFHWLKQCRRC-KCESGLKICHKTCD-ERAEGVCQSKISGMFYKDGENWT 208
            || ..||.|...:..  .:..:|..| .||.....|.:.|. |..|.:|.|. :..::::|:.|.
  Fly    65 ECLDEEPVCDGSKRR--FYKNKCTVCDPCEPLAIQCKEICPMEEPEPICLSD-NNEYHRNGDIWM 126

  Fly   209 EN--CKTCECEKG-----EPKCTMSF-CGNLNCPSEQQVMLKDTCCPVCWPKCAPMPHEKQDDGS 265
            ||  |.||.||.|     ..:|...: |.|       .|.:|..||||| |....:.:...|||:
  Fly   127 ENNGCTTCMCEGGYVTRNAVQCNHYYRCNN-------PVEVKGQCCPVC-PDELGVSNSIYDDGN 183

  Fly   266 YE-------DYVDESE-----------TPEEDSLPP--------------LLPDPLTTQQSAELV 298
            ::       ..:.|||           |...||:|.              ..|.|.|::.|:...
  Fly   184 HKYRNTTSAPILGESESSSSGWSSTVPTDTSDSVPDTSGSPNSSSTSSELATPTPNTSELSSSTE 248

  Fly   299 ATST--------------------------TTSSNGTTSTTVVP------LAATVNCNN------ 325
            .|||                          |:||:....||..|      ..:||:..:      
  Fly   249 RTSTDSSYEQLGEFATSESPDLRTDSEEQETSSSDSAMETTTNPTTFEATATSTVSSTSMELPTA 313

  Fly   326 ------------------AFDQPKVVEVVNQTNY------------------------------- 341
                              |.|:|.|: :||.||:                               
  Fly   314 TDDGITKMDFNPDGRTPKATDEPTVI-LVNATNFLSVVTDNPITNQPAVVAPESTSQIKDLNSME 377

  Fly   342 -----YFYWLVPYSVIAS-------------IAIVVMSFY-IYQQRAKKRSYDPVSI 379
                 |.|..||...|.:             |.||.:|.| |.::.:|.:.|..:.:
  Fly   378 IQQIRYPYAEVPQERIQTDWPLECVVIMGFVILIVFISLYAIVKRYSKNKKYHAIPL 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13252NP_649248.3 VWC 197..249 CDD:302663 18/59 (31%)
Rcd2NP_649244.3 VWC 114..168 CDD:214564 18/61 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3256
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.