DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13252 and KCP

DIOPT Version :9

Sequence 1:NP_649248.3 Gene:CG13252 / 40289 FlyBaseID:FBgn0037016 Length:384 Species:Drosophila melanogaster
Sequence 2:XP_016867673.1 Gene:KCP / 375616 HGNCID:17585 Length:1633 Species:Homo sapiens


Alignment Length:298 Identity:71/298 - (23%)
Similarity:93/298 - (31%) Gaps:110/298 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 EPLPDLCQSVKC-----------------PPDAEMQCPADSSIRHNLLAVDLIKSNAVELPNASE 79
            ||.|:...|::|                 ||..:..||                :.|..|.|.||
Human  1041 EPQPEGPPSLRCHRRQCPSLVGCPPSQLLPPGPQHCCP----------------TCAEALSNCSE 1089

  Fly    80 MASAADGVSYNRGLISDE----DYVQCC----LNRKCVCKTCYIPDCPSDADEDVVVVELVPENN 136
                        ||:..|    |....|    |...|:.:.|....||            :.|.:
Human  1090 ------------GLLGSELAPPDPCYTCQCQDLTWLCIHQACPELSCP------------LSERH 1130

  Fly   137 QTPGECCGT-YECQAEPNCTVVRDTDFHW---LKQCRRCKCESGLKICH---------------- 181
            ..||.||.. .||..|.....|.|.: .|   ...|..|.|..|...||                
Human  1131 TPPGSCCPVCRECVVEAEGRRVADGE-SWRDPSNACIACTCHRGHVECHLEECQALSCPHGWAKV 1194

  Fly   182 ---KTCDERAEGVCQSKI----------SGMFYKDGENWT-ENCKTCECEKGEPKCTMSFCGNLN 232
               .:|.||    ||:.|          .|.....||.|| :.|.:|.|..|..:|....|..|:
Human  1195 PQADSCCER----CQAPIPSAPTQSCVHQGREVASGERWTVDTCTSCSCMAGTVRCQSQRCSPLS 1255

  Fly   233 C-PSEQQVMLKDTCCPVCWPKCAPM-----PHEKQDDG 264
            | |.:...:...:|||.|.|:.|..     ||.:..||
Human  1256 CGPDKAPALSPGSCCPRCLPRPASCMAFGDPHYRTFDG 1293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13252NP_649248.3 VWC 197..249 CDD:302663 17/53 (32%)
KCPXP_016867673.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.