DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13252 and Ndp

DIOPT Version :9

Sequence 1:NP_649248.3 Gene:CG13252 / 40289 FlyBaseID:FBgn0037016 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001102284.1 Gene:Ndp / 363443 RGDID:1563968 Length:131 Species:Rattus norvegicus


Alignment Length:111 Identity:21/111 - (18%)
Similarity:32/111 - (28%) Gaps:49/111 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 TDFHWLKQCRRC--------------KCESGLKICHKTCDERAEGVCQSKISGMFYKDGENWTEN 210
            ||..:|...:||              ||.|.:.:.     .|.||.|.                 
  Rat    26 TDSSFLMDSQRCMRHHYVDSISHPLYKCSSKMVLL-----ARCEGHCS----------------- 68

  Fly   211 CKTCECEKGEPKCTMSFCGNLNCPSEQQVMLKDTCCPVCWPKCAPM 256
                :..:.||  .:||...|..|..       :.|..|.|:.:.:
  Rat    69 ----QASRSEP--LVSFSTVLKQPFR-------SSCHCCRPQTSKL 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13252NP_649248.3 VWC 197..249 CDD:302663 7/51 (14%)
NdpNP_001102284.1 CT 41..127 CDD:214482 16/96 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.