DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13252 and Vit

DIOPT Version :9

Sequence 1:NP_649248.3 Gene:CG13252 / 40289 FlyBaseID:FBgn0037016 Length:384 Species:Drosophila melanogaster
Sequence 2:XP_008762649.1 Gene:Vit / 313831 RGDID:1564128 Length:651 Species:Rattus norvegicus


Alignment Length:207 Identity:41/207 - (19%)
Similarity:72/207 - (34%) Gaps:61/207 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 DERAEGVCQSKISGM-FYKDG----------ENWTENCKTCECEKGEPKCTMSFCGNLNCPSEQQ 238
            |:....:...|::|. |||..          ..|.|:....|   .:|:..:::...|...|   
  Rat    97 DDSGGKILVRKVAGQSFYKGSYSNGVQSLSLPRWRESFVVSE---SKPQKGVTYPSTLTYSS--- 155

  Fly   239 VMLKDTCCPVCWPKCAPMPHEKQDDGSYEDYVDESETP---EEDSLPPLLPDPLTTQQSAELVAT 300
                        ||.|.              .:..||.   |:.|||.....|:|..|:   :||
  Rat   156 ------------PKTAA--------------ANAGETTKAYEKPSLPGTTAQPVTLSQA---LAT 191

  Fly   301 STTTSSNGTTSTTVVPLAATVNCNNAFDQPKVVEVVNQTNYYFYWLVPYSVIASIAIVVMSFYIY 365
            ....:::..||.   |.||:|..::   :|:.|...:|.........|..|:..      |.::.
  Rat   192 PVAEATHRATSK---PFAASVTSSS---RPQPVGHRSQEMEEMATWKPEPVLLD------SGFVP 244

  Fly   366 QQRAKKRSYDPV 377
            ::....:|.:||
  Rat   245 KEELSTQSSEPV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13252NP_649248.3 VWC 197..249 CDD:302663 10/62 (16%)
VitXP_008762649.1 LCCL 45..134 CDD:281766 8/36 (22%)
vWA_collagen 265..409 CDD:238749
vWA_collagen 467..627 CDD:238749
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.