DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13252 and Bmper

DIOPT Version :9

Sequence 1:NP_649248.3 Gene:CG13252 / 40289 FlyBaseID:FBgn0037016 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001129271.1 Gene:Bmper / 300455 RGDID:1563373 Length:685 Species:Rattus norvegicus


Alignment Length:344 Identity:78/344 - (22%)
Similarity:114/344 - (33%) Gaps:122/344 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 PDAEMQCP----ADSSIRHNLLAVDLIKSNAVELPNASEMASAA---------DGVSYNRGLISD 96
            |.|..||.    .:|.:|           ..|...|.:|...|.         :||.|..|    
  Rat   127 PCALRQCQEGVVTESEVR-----------CVVHCKNPAEHPGACCPTCPGCVFEGVQYREG---- 176

  Fly    97 EDY-------VQC-CL--NRKCVCKTCYIPDCPSDADEDVVVVELVPENNQTP-GECCGTYECQA 150
            |::       ::| |:  ..:||.:.|.|..||...             :.|| |:||       
  Rat   177 EEFQPEANKCIKCSCVGGRTQCVREVCPILSCPQHL-------------SHTPSGQCC------- 221

  Fly   151 EPNCTVVR---DTDF---------------HWLKQCRRCKCESGLKICHKTCDERAEGVCQS--- 194
             |.|...|   |..|               .....|..|.|:....:|.|.|..  .|||.:   
  Rat   222 -PKCLGQRKVFDLPFGSCLFRSDVYDNGASFVYDNCTVCTCKDSTMVCKKKCSH--PGVCNTDED 283

  Fly   195 ------------------KISGMFYKDGENWTE-NCKTCECEKGEPKCTMSFCGNL-NCPSEQQV 239
                              |.....::|||.|:. ||..|.|.||:.:|....|..: :|| :.::
  Rat   284 ACCEECLLRVPPEDVKVCKFGSKIFRDGEMWSSVNCSICACVKGKTECRKKQCVPVSSCP-QGKI 347

  Fly   240 MLKDTCCPVCWPK---CAPM--PHEKQDDGSYEDYVDESE-TPEEDSLPPLLP-------DPLTT 291
            :.:..|||:|..|   |...  ||....||...::....: ...:|...|..|       |...|
  Rat   348 LNRKGCCPICTEKPGVCTVFGDPHYNTFDGRTFNFQGTCQYVLTKDCSSPASPFQVLVKNDARRT 412

  Fly   292 Q-----QSAELVATSTTTS 305
            :     :|.|||...:|.|
  Rat   413 RSFSWTKSVELVLGESTVS 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13252NP_649248.3 VWC 197..249 CDD:302663 17/53 (32%)
BmperNP_001129271.1 VWC 166..224 CDD:278520 19/82 (23%)
VWC 301..357 CDD:302663 18/56 (32%)
VWD 364..508 CDD:278521 16/68 (24%)
C8 556..624 CDD:285899
TIL 629..682 CDD:280072
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.