DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13252 and Crim1

DIOPT Version :10

Sequence 1:NP_649248.3 Gene:CG13252 / 40289 FlyBaseID:FBgn0037016 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001162574.1 Gene:Crim1 / 298744 RGDID:1308710 Length:1037 Species:Rattus norvegicus


Alignment Length:321 Identity:82/321 - (25%)
Similarity:121/321 - (37%) Gaps:97/321 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PRRCLHQMLII-YVLIFVSSAT--------TLDQEPLPDL-CQSVKCPPDAEMQCPADSSIRHNL 61
            |..||.::... |:.|.||.|:        ..:.:|:..: |.:|:|||..:..||.||      
  Rat   214 PAGCLRKVCQPGYLNILVSKASGKPGECCDLYECKPVFSVDCSTVECPPVQQAVCPLDS------ 272

  Fly    62 LAVDLIKSNAVELPNASEMASAADGVSYNRGLISDEDYVQCC-LNRKCVCKT--CYIPDCPSDAD 123
                          ..:::...|||               || |..:|.|.:  |..|.|     
  Rat   273 --------------YETQVRLTADG---------------CCTLPARCECLSGLCAFPVC----- 303

  Fly   124 EDVVVVELVPENNQTPGECCGTYEC--QAEPNCTV----VRDTDFHWLKQCRRCKCESGLKICHK 182
            |......:|...:.|||:||..:||  :.:|.|..    ..|.|...:..||.|:|:.|:.||..
  Rat   304 EVGSTPRIVSRGDGTPGKCCDVFECVNETKPACVFNSVEYYDGDMFRMDNCRFCRCQGGVSICFT 368

  Fly   183 T-CDER-------AEG----VCQSKI-----------SGMFYKDGENWTE-NCKTCECEKGEPKC 223
            . |.|.       .||    ||:..|           :|.....|:.|.| :|..|:|..|||.|
  Rat   369 AQCGELNCERYYVPEGECCPVCEDPIYPFNNPAGCYANGQIRAHGDRWREDDCTFCQCINGEPHC 433

  Fly   224 TMSFCGNLNCPSEQQVMLKDTCCPVCW---------PKCAPMPH--EKQDDGSYEDYVDES 273
            ..:.||. :|  ...|.:...|||||.         |.|..:.:  .|:.|..|...:|.:
  Rat   434 VATACGQ-SC--MHPVKVPGECCPVCEEPTYITIDPPACGELSNCTLKEKDCVYGFKLDHN 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13252NP_649248.3 VWC 197..249 CDD:450195 18/52 (35%)
Crim1NP_001162574.1 IGFBP 39..90 CDD:459717
VWC 336..390 CDD:214564 14/53 (26%)
VWC 403..456 CDD:214564 18/55 (33%)
Antistasin 539..564 CDD:460713
Antistasin 567..592 CDD:460713
VWC 612..662 CDD:450195
VWC 683..734 CDD:450195
VWC 758..808 CDD:450195
VWC 819..873 CDD:450195
CRIM1_C 907..1037 CDD:437274
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.