DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13252 and Crim1

DIOPT Version :9

Sequence 1:NP_649248.3 Gene:CG13252 / 40289 FlyBaseID:FBgn0037016 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001162574.1 Gene:Crim1 / 298744 RGDID:1308710 Length:1037 Species:Rattus norvegicus


Alignment Length:321 Identity:82/321 - (25%)
Similarity:121/321 - (37%) Gaps:97/321 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PRRCLHQMLII-YVLIFVSSAT--------TLDQEPLPDL-CQSVKCPPDAEMQCPADSSIRHNL 61
            |..||.::... |:.|.||.|:        ..:.:|:..: |.:|:|||..:..||.||      
  Rat   214 PAGCLRKVCQPGYLNILVSKASGKPGECCDLYECKPVFSVDCSTVECPPVQQAVCPLDS------ 272

  Fly    62 LAVDLIKSNAVELPNASEMASAADGVSYNRGLISDEDYVQCC-LNRKCVCKT--CYIPDCPSDAD 123
                          ..:::...|||               || |..:|.|.:  |..|.|     
  Rat   273 --------------YETQVRLTADG---------------CCTLPARCECLSGLCAFPVC----- 303

  Fly   124 EDVVVVELVPENNQTPGECCGTYEC--QAEPNCTV----VRDTDFHWLKQCRRCKCESGLKICHK 182
            |......:|...:.|||:||..:||  :.:|.|..    ..|.|...:..||.|:|:.|:.||..
  Rat   304 EVGSTPRIVSRGDGTPGKCCDVFECVNETKPACVFNSVEYYDGDMFRMDNCRFCRCQGGVSICFT 368

  Fly   183 T-CDER-------AEG----VCQSKI-----------SGMFYKDGENWTE-NCKTCECEKGEPKC 223
            . |.|.       .||    ||:..|           :|.....|:.|.| :|..|:|..|||.|
  Rat   369 AQCGELNCERYYVPEGECCPVCEDPIYPFNNPAGCYANGQIRAHGDRWREDDCTFCQCINGEPHC 433

  Fly   224 TMSFCGNLNCPSEQQVMLKDTCCPVCW---------PKCAPMPH--EKQDDGSYEDYVDES 273
            ..:.||. :|  ...|.:...|||||.         |.|..:.:  .|:.|..|...:|.:
  Rat   434 VATACGQ-SC--MHPVKVPGECCPVCEEPTYITIDPPACGELSNCTLKEKDCVYGFKLDHN 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13252NP_649248.3 VWC 197..249 CDD:302663 18/52 (35%)
Crim1NP_001162574.1 IB 37..>95 CDD:197525
VWC 336..390 CDD:214564 14/53 (26%)
VWC 403..456 CDD:214564 18/55 (33%)
Antistasin 567..592 CDD:280912
VWC 612..662 CDD:302663
VWC 683..734 CDD:302663
VWC 758..808 CDD:302663
VWC 819..873 CDD:302663
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.