DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13252 and Fras1

DIOPT Version :9

Sequence 1:NP_649248.3 Gene:CG13252 / 40289 FlyBaseID:FBgn0037016 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_780682.3 Gene:Fras1 / 231470 MGIID:2385368 Length:4010 Species:Mus musculus


Alignment Length:341 Identity:75/341 - (21%)
Similarity:110/341 - (32%) Gaps:127/341 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 CLHQMLIIYVLIFVSSATTLDQEPLPDLCQSVKCPPD------------------------AEMQ 50
            ||:|.      .|::.||...    ||.||:.:|..|                        |..|
Mouse    27 CLYQG------SFLADATIWK----PDSCQNCRCHGDIVICKPVVCKNPRCAFEKGEVLWIAPNQ 81

  Fly    51 C------PADSSIRHNLLAVDLIKSNAVELPNA--------------------------SEMASA 83
            |      ....|..|.    ..|..:..|..:|                          .|:...
Mouse    82 CCPQCAPRTPGSCHHE----GKIHEHGTEWASAPCTVCSCTHGEVRCSHQQCTPLSCGPQELEFL 142

  Fly    84 ADG------------VSYNRGLISDEDYVQCCLNRKCVCKT----CYIPDC-PSDADEDVVVVEL 131
            |:|            .||:..:..|.:..|.....||||:.    |:...| |...::|.:||  
Mouse   143 AEGRCCPICVGTGKPCSYDGHVFQDGEDWQLSRCAKCVCRNGLTQCFAAQCQPLFCNQDEIVV-- 205

  Fly   132 VPENNQTPGECCGTYECQAEPNCTVVRDTDFH---WLKQ-CRRCKCESGLKICHK---------- 182
                 :.||:||.  :|.|. :|:.......|   |.:. |..|.|:.|...|||          
Mouse   206 -----RVPGKCCS--QCSAR-SCSTAGQVYEHGEQWKEDACTLCMCDQGQVRCHKQVCPPLRCAK 262

  Fly   183 ----------TCDERA--EGVCQSKISGMFYKDGENWTEN-CKTCECEKGEPKCTMSFCGNLNCP 234
                      .|:|.|  :..|.|  .|:.....|.|..: |:.|.|::|:..|....|..:.|.
Mouse   263 GQGRARHHGQCCEECATPDRSCSS--GGVLRYQDEMWKGSACEFCMCDQGQVTCQTGECAKVACA 325

  Fly   235 -SEQQVMLKDTCCPVC 249
             .|:.|.|:..|||.|
Mouse   326 LGEELVHLEGKCCPEC 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13252NP_649248.3 VWC 197..249 CDD:302663 16/53 (30%)
Fras1NP_780682.3 VWC 27..86 CDD:214564 15/68 (22%)
VWC 94..151 CDD:278520 7/60 (12%)
VWC 158..215 CDD:278520 18/65 (28%)
VWC 220..277 CDD:278520 11/56 (20%)
VWC 284..341 CDD:302663 18/58 (31%)
VWC 368..415 CDD:302663
FU 1 408..459
GF_recep_IV 411..527 CDD:291509
FU 420..>458 CDD:238021
FU 2 461..504
FU 461..503 CDD:214589
FU 3 506..552
FU 507..551 CDD:214589
GF_recep_IV 511..623 CDD:291509
FU 4 554..598
FU 555..597 CDD:214589
FU 5 601..646
GF_recep_IV 606..728 CDD:291509
FU 607..652 CDD:238021
FU 6 648..704
FU 649..703 CDD:214589
FU 7 707..752
FU 707..751 CDD:214589
FU 8 754..799
FU 754..798 CDD:214589
Furin-like 759..912 CDD:279142
FU 9 802..851
FU 803..850 CDD:214589
FU 10 853..899
FU 853..898 CDD:214589
FU 11 902..947
Furin-like 905..1055 CDD:279142
FU 12 951..996
FU 951..995 CDD:214589
FU 13 998..1041
FU 1004..1048 CDD:238021
Furin-like_2 1008..1098 CDD:292535
FU 14 1045..1088
FU 1045..1086 CDD:214589
Cadherin_3 <1101..1197 CDD:292802
CSPG 1. /evidence=ECO:0000255|PROSITE-ProRule:PRU01201 1101..1196
Cadherin_3 1167..1309 CDD:292802
CSPG 2. /evidence=ECO:0000255|PROSITE-ProRule:PRU01201 1216..1307
Cadherin_3 1278..1440 CDD:292802
CSPG 3. /evidence=ECO:0000255|PROSITE-ProRule:PRU01201 1328..1440
Cadherin_3 1411..1576 CDD:292802
CSPG 4. /evidence=ECO:0000255|PROSITE-ProRule:PRU01201 1465..1561
Cadherin_3 1531..1693 CDD:292802
CSPG 5. /evidence=ECO:0000255|PROSITE-ProRule:PRU01201 1597..1691
Cadherin_3 1662..1813 CDD:292802
CSPG 6. /evidence=ECO:0000255|PROSITE-ProRule:PRU01201 1712..1812
Cadherin_3 1780..1940 CDD:292802
CSPG 7. /evidence=ECO:0000255|PROSITE-ProRule:PRU01201 1834..1938
Cadherin_3 1906..2061 CDD:292802
CSPG 8. /evidence=ECO:0000255|PROSITE-ProRule:PRU01201 1959..2059
Cadherin_3 2030..2181 CDD:292802
CSPG 9. /evidence=ECO:0000255|PROSITE-ProRule:PRU01201 2080..2179
Cadherin_3 2149..2295 CDD:292802
CSPG 10. /evidence=ECO:0000255|PROSITE-ProRule:PRU01201 2201..2293
Cadherin_3 2263..2408 CDD:292802
CSPG 11. /evidence=ECO:0000255|PROSITE-ProRule:PRU01201 2313..2406
Cadherin_3 2377..2539 CDD:292802
CSPG 12. /evidence=ECO:0000255|PROSITE-ProRule:PRU01201 2441..2538
Calx-beta 2555..2648 CDD:295344
Calx-beta 2673..2759 CDD:295344
Calx-beta 2796..2892 CDD:295344
Calx-beta 2918..3009 CDD:295344
Calx-beta 3037..3131 CDD:295344
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.