DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13252 and Tecta

DIOPT Version :9

Sequence 1:NP_649248.3 Gene:CG13252 / 40289 FlyBaseID:FBgn0037016 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001365531.1 Gene:Tecta / 21683 MGIID:109575 Length:2155 Species:Mus musculus


Alignment Length:298 Identity:62/298 - (20%)
Similarity:91/298 - (30%) Gaps:109/298 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 FVSSATTL----DQEPLPDLCQSVKCPPDAEMQCPADSSIRHNLLAVDLIKS------------- 69
            :::|...|    ::.||.|..:     ||..   ||.|       .:||.:|             
Mouse   453 YINSTCGLCGNYNKNPLDDFLR-----PDGR---PAMS-------VLDLGESWRVYHADWKCGSG 502

  Fly    70 ---NAVELPNASE----------MASAADGVSYNRGLISDED-YVQCCLNRKC------------ 108
               |..:...|:|          ..:..||..:..|.:.|.. :|..|:...|            
Mouse   503 CVDNCTQCDAATEALYFGSDYCGFLNKTDGPLWECGTVVDATAFVHSCVYDLCSVRDNGTLLCQA 567

  Fly   109 ------VCKTCYIP--------------DCPSDADEDVVVVELVPENNQTPGECCGTYECQAEPN 153
                  ||:...||              .|||.:...|.       .:..|..|.   :..|..|
Mouse   568 IQAYALVCQALGIPIGDWRIQTGCVSTVRCPSFSHYSVC-------TSSCPDTCS---DLTASQN 622

  Fly   154 CTVVRDTDFHWLKQCRR-CKCESGLKICHKTCDERAEGVCQSKISGMFYKDGE-NW-TENCKT-C 214
            |..          .|.. |:|..|..:....|....:  |.....|.:|..|| .| |.||.. |
Mouse   623 CAT----------PCTEGCECNEGFVLSTSQCVPLHK--CGCDFDGHYYTMGEFFWATANCTVQC 675

  Fly   215 ECEKGEPKCTMSFCGNLNCPSEQQVMLKDTCCPVCWPK 252
            .||:|..    .:|.|..|.|.:...::|. ...|:||
Mouse   676 LCEEGGD----VYCFNKTCRSGEVCAVEDG-YQGCFPK 708

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13252NP_649248.3 VWC 197..249 CDD:302663 17/54 (31%)
TectaNP_001365531.1 NIDO 98..254 CDD:214712
VWD 322..478 CDD:395046 7/29 (24%)
C8 517..591 CDD:214843 11/73 (15%)
TIL 597..650 CDD:410995 14/74 (19%)
VWC 652..706 CDD:327433 17/58 (29%)
VWD 703..865 CDD:214566 3/6 (50%)
C8 905..981 CDD:214843
TIL 984..1036 CDD:410995
VWD 1100..1258 CDD:395046
C8 1300..1368 CDD:400886
TIL 1372..1425 CDD:410995
VWD 1487..1639 CDD:395046
C8 1685..1757 CDD:214843
ZP 1805..2059 CDD:214579
FXa_inhibition 2089..2121 CDD:405372
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.