DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13252 and Fcgbp

DIOPT Version :9

Sequence 1:NP_649248.3 Gene:CG13252 / 40289 FlyBaseID:FBgn0037016 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001116075.1 Gene:Fcgbp / 215384 MGIID:2444336 Length:2583 Species:Mus musculus


Alignment Length:424 Identity:88/424 - (20%)
Similarity:138/424 - (32%) Gaps:141/424 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 QEPLPDL-CQSVKCPP----DAEMQC-PADSSIRHNLLAVDLIKSNAVELPNASEMASAADGVSY 89
            :|.:||. |..|  ||    |.:.:| |......|......|:.|....|....::...      
Mouse  1004 EEAVPDSPCAPV--PPCTGDDCDTECSPELQDKYHGEQFCGLLTSPTGPLAACHKLLDP------ 1060

  Fly    90 NRGLISDEDYVQC----CL---NRKCVCKT--CYIPDCPSDADEDVVVVELVPENNQT--PGEC- 142
             :|.:.|     |    ||   |:..:|..  .|:..|.:...:    ||  |...:|  |.|| 
Mouse  1061 -QGPLQD-----CVFDLCLGGGNQSILCNIIHAYVSACQAAGGQ----VE--PWRTETFCPMECP 1113

  Fly   143 -CGTYECQAEP---NCTVVRDTDFHWLKQC-----RRCKCESGLKICHKTCDERAEGVCQSKISG 198
             ...||..|:.   .|..:...     :||     ..|:|:||.....|.|....:  |....:|
Mouse  1114 PHSHYEVCADTCSLGCWALNTP-----QQCPEGCAEGCECDSGFLYNGKACVPIEQ--CGCYHNG 1171

  Fly   199 MFYKDGEN-WTENCKT-CECEKGE-PKCTMSFC----------GNLNCPSEQQVMLKDTCCPV-C 249
            ::|:..|: ..|||:. |.|:.|: ..|....|          |.|.|      :.||.|..: |
Mouse  1172 VYYEPEESVLIENCQQHCVCQPGKGMMCQDHSCKPGQVCEPSGGVLTC------VTKDPCHGITC 1230

  Fly   250 WPK-----------CAPM----------PHEKQDDGSYEDYVDESETPEEDSLPPLLPDPLTTQQ 293
            .|:           |.|.          ||....||...|:        :.:...||...|....
Mouse  1231 RPQETCKVQGGEGVCVPNYNSTCWLWGDPHYNSFDGWSFDF--------QGTCNYLLAGTLCPGV 1287

  Fly   294 SAELVATSTTTSSNGTTSTTVVP-----LAATVNCNNAFDQPKV--------------------V 333
            :||.:...|.|:.|....:..|.     ...|:|.|.:..:.::                    :
Mouse  1288 NAEGLTPFTVTTKNENRGSPAVSYVRQVTVTTLNTNISIHKNEIGKVRVNGVLMALPVYLAGGRI 1352

  Fly   334 EVVN-------------QTNYYFYWLVPYSVIAS 354
            .|:|             |..|.:.|.|..::.:|
Mouse  1353 SVINGGSKAVLETDFGLQVTYDWNWRVDVTLPSS 1386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13252NP_649248.3 VWC 197..249 CDD:302663 17/65 (26%)
FcgbpNP_001116075.1 VWD 56..210 CDD:278521
C8 251..326 CDD:214843
TIL 329..383 CDD:280072
VWD 448..603 CDD:278521
C8 644..717 CDD:214843
TIL 720..773 CDD:280072
VWC 778..829 CDD:302663
VWD 836..991 CDD:278521
C8 1034..1109 CDD:214843 17/92 (18%)
TIL 1112..1165 CDD:280072 13/59 (22%)
VWC 1167..1220 CDD:302663 14/58 (24%)
VWD 1253..1412 CDD:278521 24/142 (17%)
C8 1451..1526 CDD:214843
TIL 1530..1584 CDD:280072
VWD 1652..1803 CDD:278521
C8 1840..1914 CDD:214843
TIL 1917..1970 CDD:280072
VWD 2034..2180 CDD:278521
C8 2222..2296 CDD:214843
TIL 2299..2352 CDD:280072
VWC 2357..2407 CDD:302663
VWD 2413..2567 CDD:295339
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.