powered by:
Protein Alignment CG13252 and C16E9.1
DIOPT Version :9
Sequence 1: | NP_649248.3 |
Gene: | CG13252 / 40289 |
FlyBaseID: | FBgn0037016 |
Length: | 384 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_509176.2 |
Gene: | C16E9.1 / 182693 |
WormBaseID: | WBGene00015865 |
Length: | 565 |
Species: | Caenorhabditis elegans |
Alignment Length: | 36 |
Identity: | 11/36 - (30%) |
Similarity: | 16/36 - (44%) |
Gaps: | 9/36 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 32 EPLPDLCQS---------VKCPPDAEMQCPADSSIR 58
:.|||:.:: |.||.|......|.||:|
Worm 136 DSLPDIMKAMDSEAEVLGVNCPSDIIFVIDATSSVR 171
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1216 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.