DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13252 and Muc5ac

DIOPT Version :9

Sequence 1:NP_649248.3 Gene:CG13252 / 40289 FlyBaseID:FBgn0037016 Length:384 Species:Drosophila melanogaster
Sequence 2:XP_006508562.1 Gene:Muc5ac / 17833 MGIID:104697 Length:3459 Species:Mus musculus


Alignment Length:268 Identity:64/268 - (23%)
Similarity:92/268 - (34%) Gaps:95/268 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 CQSVKCPPDAEMQCPADSSIRHNLLAVDLIKSNAVELPNASEMASAADGVSYNRGLISDEDYVQC 102
            ||...||   :..||               :...|.:|.|.|..                   ||
Mouse  3114 CQKKACP---QPTCP---------------EPGFVPVPVALEAG-------------------QC 3141

  Fly   103 CLNRKCVCKTCYIP---DCPSDADEDVVVVELVPENNQTPGECCGTYECQAEPNC----TVVRDT 160
            |....|.|.:.:.|   .||.::...|...|         |.||.|..|.::..|    |:.:..
Mouse  3142 CPQFSCACNSSHCPPPLHCPKNSSLIVTYEE---------GACCPTQNCSSQKGCEVNGTLYQPG 3197

  Fly   161 DFHWLKQCRRCKCESG-------------LKICHKTCDERAE-----GVCQSKI----------- 196
            |......|.||.||..             .::|:..|.:.:|     |.|..|.           
Mouse  3198 DVVSSSLCERCLCEVSSNPLSDVFMVSCETELCNTQCPKGSEYQAMPGQCCGKCIPKTCPFKNNS 3262

  Fly   197 -SGMFYKDGENWTE---NCKTCECEKGEP---KCTM-SFCGNLNCPSEQQVMLKDTCCPVCWPKC 253
             |..||:.||.|.|   .|.|.:|||.:.   ..|| :.|..:|||..|..:.:|.||..|    
Mouse  3263 GSTYFYQPGELWAEPGNPCVTHKCEKFQDVLMVVTMKTECPKINCPQGQAQLREDGCCYDC---- 3323

  Fly   254 APMPHEKQ 261
             |:|::::
Mouse  3324 -PLPNQQK 3330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13252NP_649248.3 VWC 197..249 CDD:302663 22/58 (38%)
Muc5acXP_006508562.1 VWD 77..230 CDD:214566
C8 269..337 CDD:370094
TIL 341..397 CDD:366828
VWD 426..590 CDD:214566
C8 627..697 CDD:214843
TIL 707..764 CDD:366828
TIL 805..866 CDD:366828
VWD 895..1054 CDD:214566
C8 1091..1165 CDD:214843
Mucin2_WxxW 1400..1486 CDD:372569
Mucin2_WxxW 1610..1696 CDD:372569
Mucin2_WxxW 1771..1861 CDD:372569
Herpes_BLLF1 <2057..2259 CDD:282904
Mucin2_WxxW 2313..2399 CDD:372569
Mucin2_WxxW 2474..2564 CDD:372569
VWD 2739..2907 CDD:214566
C8 2953..3015 CDD:370094
PHA02682 3012..>3162 CDD:177464 17/84 (20%)
CT 3344..3416 CDD:214482
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.