Sequence 1: | NP_649248.3 | Gene: | CG13252 / 40289 | FlyBaseID: | FBgn0037016 | Length: | 384 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006508562.1 | Gene: | Muc5ac / 17833 | MGIID: | 104697 | Length: | 3459 | Species: | Mus musculus |
Alignment Length: | 268 | Identity: | 64/268 - (23%) |
---|---|---|---|
Similarity: | 92/268 - (34%) | Gaps: | 95/268 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 38 CQSVKCPPDAEMQCPADSSIRHNLLAVDLIKSNAVELPNASEMASAADGVSYNRGLISDEDYVQC 102
Fly 103 CLNRKCVCKTCYIP---DCPSDADEDVVVVELVPENNQTPGECCGTYECQAEPNC----TVVRDT 160
Fly 161 DFHWLKQCRRCKCESG-------------LKICHKTCDERAE-----GVCQSKI----------- 196
Fly 197 -SGMFYKDGENWTE---NCKTCECEKGEP---KCTM-SFCGNLNCPSEQQVMLKDTCCPVCWPKC 253
Fly 254 APMPHEKQ 261 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG13252 | NP_649248.3 | VWC | 197..249 | CDD:302663 | 22/58 (38%) |
Muc5ac | XP_006508562.1 | VWD | 77..230 | CDD:214566 | |
C8 | 269..337 | CDD:370094 | |||
TIL | 341..397 | CDD:366828 | |||
VWD | 426..590 | CDD:214566 | |||
C8 | 627..697 | CDD:214843 | |||
TIL | 707..764 | CDD:366828 | |||
TIL | 805..866 | CDD:366828 | |||
VWD | 895..1054 | CDD:214566 | |||
C8 | 1091..1165 | CDD:214843 | |||
Mucin2_WxxW | 1400..1486 | CDD:372569 | |||
Mucin2_WxxW | 1610..1696 | CDD:372569 | |||
Mucin2_WxxW | 1771..1861 | CDD:372569 | |||
Herpes_BLLF1 | <2057..2259 | CDD:282904 | |||
Mucin2_WxxW | 2313..2399 | CDD:372569 | |||
Mucin2_WxxW | 2474..2564 | CDD:372569 | |||
VWD | 2739..2907 | CDD:214566 | |||
C8 | 2953..3015 | CDD:370094 | |||
PHA02682 | 3012..>3162 | CDD:177464 | 17/84 (20%) | ||
CT | 3344..3416 | CDD:214482 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1216 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |